MAPK9 (Rattus norvegicus)
Description [+]
- Synonyms: MAPK9
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Mitogen-activated protein kinase 9 (EC 2.7.11.24) (Stress-activated protein kinase JNK2) (c-Jun N-terminal kinase 2) (SAPK-alpha) (p54- alpha). [Source:UniProtKB/Swiss-Prot;Acc:P49186]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK9-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 26 | 321 |
PFAM A | Pkinase_Tyr | 26 | 274 |
Protein sequence [+]
Mapk9 | Rattus norvegicus | 10116 | length:423
MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0010628 | positive regulation of gene expression | biological_proccess | IEA |
GO:0010744 | positive regulation of foam cell differentiation | biological_proccess | IEA |
GO:0007254 | JNK cascade | biological_proccess | IEA |
GO:0031558 | induction of apoptosis in response to chemical stimulus | biological_proccess | IEA |
GO:0046686 | response to cadmium ion | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IMP |
GO:0001934 | positive regulation of protein amino acid phosphorylation | biological_proccess | IMP |
GO:0006626 | protein targeting to mitochondrion | biological_proccess | IEP |
GO:0007258 | JUN phosphorylation | biological_proccess | IMP |
GO:0007417 | central nervous system development | biological_proccess | IEP |
GO:0009612 | response to mechanical stimulus | biological_proccess | IEP |
GO:0009636 | response to toxin | biological_proccess | IEP |
GO:0010033 | response to organic substance | biological_proccess | IEP |
GO:0010770 | positive regulation of cell morphogenesis involved in differentiation | biological_proccess | IMP |
GO:0014075 | response to amine stimulus | biological_proccess | IEP |
GO:0031175 | neurite development | biological_proccess | IMP |
GO:0031394 | positive regulation of prostaglandin biosynthetic process | biological_proccess | IMP |
GO:0031396 | regulation of protein ubiquitination | biological_proccess | IMP |
GO:0032308 | positive regulation of prostaglandin secretion | biological_proccess | IMP |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEP |
GO:0032722 | positive regulation of chemokine production | biological_proccess | IMP |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEP |
GO:0034644 | cellular response to UV | biological_proccess | IMP |
GO:0042493 | response to drug | biological_proccess | IMP |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IMP |
GO:0043280 | positive regulation of caspase activity | biological_proccess | IMP |
GO:0045429 | positive regulation of nitric oxide biosynthetic process | biological_proccess | IMP |
GO:0045941 | positive regulation of transcription | biological_proccess | IMP |
GO:0046328 | regulation of JNK cascade | biological_proccess | IMP |
GO:0051773 | positive regulation of nitric-oxide synthase 2 biosynthetic process | biological_proccess | IMP |
GO:0051789 | response to protein stimulus | biological_proccess | IEP |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004705 | JUN kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004705 | JUN kinase activity | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IDA |
GO:0008656 | caspase activator activity | mollecular_function | IMP |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0031435 | mitogen-activated protein kinase kinase kinase binding | mollecular_function | IPI |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0044445 | cytosolic part | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000002823
- Expression info from Arrayexpress [?] : ENSRNOG00000002823
- Protein expression from Protein Atlas: [?] ENSRNOG00000002823
Click on [?] for more information.