BCLX_RAT (Rattus norvegicus)
Description [+]
- Synonyms: BCLX_RAT
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Apoptosis regulator Bcl-X (Bcl-2-like 1 protein). [Source:UniProtKB/Swiss-Prot;Acc:P53563]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BCLX_RAT-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 1 | 27 |
PFAM A | Bcl-2 | 90 | 188 |
Protein sequence [+]
BCLX_RAT | Rattus norvegicus | 10116 | length:284
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDIDYSGDIPGFTLIPGVNFG
NIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDIDYSGDIPGFTLIPGVNFG
NIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT
Structure links:
- Smartdomain prediction information: SM00265
- Smartdomain prediction information: SM00337
- Prosite motif and domain information: PS01080
- Prosite motif and domain information: PS01258
- Prosite motif and domain information: PS01259
- Prosite motif and domain information: PS01260
- Interpro domain information: P53563
- PFAM domain and domain family information: P53563
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001541 | ovarian follicle development | biological_proccess | IMP |
GO:0001666 | response to hypoxia | biological_proccess | IEP |
GO:0006916 | anti-apoptosis | biological_proccess | IDA |
GO:0006979 | response to oxidative stress | biological_proccess | IEP |
GO:0010035 | response to inorganic substance | biological_proccess | IEP |
GO:0010243 | response to organic nitrogen | biological_proccess | IEP |
GO:0010288 | response to lead ion | biological_proccess | IEP |
GO:0014070 | response to organic cyclic substance | biological_proccess | IEP |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IEP |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043434 | response to peptide hormone stimulus | biological_proccess | IEP |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0007281 | germ cell development | biological_proccess | IEA |
GO:0007283 | spermatogenesis | biological_proccess | IEA |
GO:0001541 | ovarian follicle development | biological_proccess | IEA |
GO:0045768 | positive regulation of anti-apoptosis | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0009566 | fertilization | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0009314 | response to radiation | biological_proccess | IEA |
GO:0040007 | growth | biological_proccess | IEA |
GO:0046898 | response to cycloheximide | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0043027 | caspase inhibitor activity | mollecular_function | IDA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0000299 | integral to membrane of membrane fraction | cell_component | TAS |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005740 | mitochondrial envelope | cell_component | IDA |
GO:0005741 | mitochondrial outer membrane | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000007946
- Expression info from Arrayexpress [?] : ENSRNOG00000007946
- Protein expression from Protein Atlas: [?] ENSRNOG00000007946
- entrezgene: 24888
- refseq_dna: NM_001033670
- refseq_dna: NM_001033672
- refseq_dna: NM_031535
- refseq_peptide: NP_001028842
- refseq_peptide: NP_113723
- refseq_peptide: NP_001028844
Click on [?] for more information.