TP53 (Rattus norvegicus)
Description [+]
- Synonyms: TP53
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Cellular tumor antigen p53 (Tumor suppressor p53). [Source:UniProtKB/Swiss-Prot;Acc:P10361]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TP53-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53_TAD | 5 | 29 |
PFAM A | P53 | 93 | 287 |
PFAM A | P53_tetramer | 316 | 357 |
Protein sequence [+]
Tp53 | Rattus norvegicus | 10116 | length:391
MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPE
EALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSV
MCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERC
SDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSC
MGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPG
SAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDS
RAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
EALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSV
MCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERC
SDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSC
MGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPG
SAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDS
RAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002687 | positive regulation of leukocyte migration | biological_proccess | IMP |
GO:0006357 | regulation of transcription from RNA polymerase II promoter | biological_proccess | TAS |
GO:0006979 | response to oxidative stress | biological_proccess | IEP |
GO:0007568 | aging | biological_proccess | IEP |
GO:0009411 | response to UV | biological_proccess | IEP |
GO:0010038 | response to metal ion | biological_proccess | IEP |
GO:0010165 | response to X-ray | biological_proccess | IEP |
GO:0010243 | response to organic nitrogen | biological_proccess | IEP |
GO:0014070 | response to organic cyclic substance | biological_proccess | IEP |
GO:0030308 | negative regulation of cell growth | biological_proccess | TAS |
GO:0031000 | response to caffeine | biological_proccess | IEP |
GO:0032526 | response to retinoic acid | biological_proccess | IEP |
GO:0033552 | response to vitamin B3 | biological_proccess | IEP |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEP |
GO:0042060 | wound healing | biological_proccess | IEP |
GO:0042493 | response to drug | biological_proccess | IEP |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IMP |
GO:0043200 | response to amino acid stimulus | biological_proccess | IEP |
GO:0045787 | positive regulation of cell cycle | biological_proccess | IMP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | biological_proccess | IMP |
GO:0051453 | regulation of intracellular pH | biological_proccess | IMP |
GO:0055093 | response to hyperoxia | biological_proccess | IEP |
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0006289 | nucleotide-excision repair | biological_proccess | ISS |
GO:0007275 | multicellular organismal development | biological_proccess | ISS |
GO:0007569 | cell aging | biological_proccess | ISS |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | ISS |
GO:0010552 | positive regulation of specific transcription from RNA polymerase II promoter | biological_proccess | IDA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0002309 | T cell proliferation during immune response | biological_proccess | IEA |
GO:0002326 | B cell lineage commitment | biological_proccess | IEA |
GO:0002360 | T cell lineage commitment | biological_proccess | IEA |
GO:0006302 | double-strand break repair | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0007369 | gastrulation | biological_proccess | IEA |
GO:0007406 | negative regulation of neuroblast proliferation | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0008156 | negative regulation of DNA replication | biological_proccess | IEA |
GO:0009651 | response to salt stress | biological_proccess | IEA |
GO:0009792 | embryonic development ending in birth or egg hatching | biological_proccess | IEA |
GO:0010165 | response to X-ray | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0031571 | G1 DNA damage checkpoint | biological_proccess | IEA |
GO:0033077 | T cell differentiation in the thymus | biological_proccess | IEA |
GO:0034644 | cellular response to UV | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0048147 | negative regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0051276 | chromosome organization | biological_proccess | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0003702 | RNA polymerase II transcription factor activity | mollecular_function | TAS |
GO:0043565 | sequence-specific DNA binding | mollecular_function | IDA |
GO:0000739 | DNA strand annealing activity | mollecular_function | ISS |
GO:0005507 | copper ion binding | mollecular_function | ISS |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0005524 | ATP binding | mollecular_function | ISS |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0000785 | chromatin | cell_component | IDA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005667 | transcription factor complex | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IMP |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0005730 | nucleolus | cell_component | ISS |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005657 | replication fork | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000010756
- Expression info from Arrayexpress [?] : ENSRNOG00000010756
- Protein expression from Protein Atlas: [?] ENSRNOG00000010756
Click on [?] for more information.