ANXA1_RAT (Rattus norvegicus)
Description [+]
- Synonyms: ANXA1_RAT
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Annexin A1 (Annexin-1)(Annexin I)(Lipocortin I)(Calpactin II)(Chromobindin-9)(p35)(Phospholipase A2 inhibitory protein) [Source:UniProtKB/Swiss-Prot;Acc:P07150]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANXA1_RAT-R_norvegicus
Structure & Sequence [+]
Protein sequence [+]
ANXA1_RAT | Rattus norvegicus | 10116 | length:385
MAMVSEFLKQACYIEKQEQEYVQAVKSYKGGPGSAVSPYPSFNPSSDVAALHKAIMVKGV
DEATIIDILTKRTNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLAMLKTPAQFDA
DELRAAMKGLGTDEDTLIEILTTRSNQQIREITRVYREELKRDLAKDITSDTSGDFRNAL
LALAKGDRCEDMSVNQDLADTDARALYEAGERRKGTDVNVFNTILTTRSYPHLRKVFQNY
RKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAFFAEKLYEAMKGAGTRHKTLIRIM
VSRSEIDMKSKYFTRRSTESLSAKPSWMKPKETMKKSWWLCVEETKHPNCSVRFRGEHLL
AVVFFLLQGLSRKVALSVSLITFFE
DEATIIDILTKRTNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLAMLKTPAQFDA
DELRAAMKGLGTDEDTLIEILTTRSNQQIREITRVYREELKRDLAKDITSDTSGDFRNAL
LALAKGDRCEDMSVNQDLADTDARALYEAGERRKGTDVNVFNTILTTRSYPHLRKVFQNY
RKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAFFAEKLYEAMKGAGTRHKTLIRIM
VSRSEIDMKSKYFTRRSTESLSAKPSWMKPKETMKKSWWLCVEETKHPNCSVRFRGEHLL
AVVFFLLQGLSRKVALSVSLITFFE
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002674 | negative regulation of acute inflammatory response | biological_proccess | IDA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IDA |
GO:0010165 | response to X-ray | biological_proccess | IEP |
GO:0014070 | response to organic cyclic substance | biological_proccess | IEP |
GO:0030073 | insulin secretion | biological_proccess | IDA |
GO:0031018 | endocrine pancreas development | biological_proccess | IEP |
GO:0031394 | positive regulation of prostaglandin biosynthetic process | biological_proccess | IMP |
GO:0032355 | response to estradiol stimulus | biological_proccess | IEP |
GO:0042063 | gliogenesis | biological_proccess | IEP |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEP |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IMP |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IDA |
GO:0043434 | response to peptide hormone stimulus | biological_proccess | IEP |
GO:0050482 | arachidonic acid secretion | biological_proccess | IEA |
GO:0050709 | negative regulation of protein secretion | biological_proccess | IMP |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEP |
GO:0060206 | estrous cycle phase | biological_proccess | IEP |
GO:0070301 | cellular response to hydrogen peroxide | biological_proccess | IMP |
GO:0070365 | hepatocyte differentiation | biological_proccess | IEP |
GO:0070555 | biological_proccess | IEP | |
GO:0007010 | cytoskeleton organization | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0018149 | peptide cross-linking | biological_proccess | IEA |
GO:0030216 | keratinocyte differentiation | biological_proccess | IEA |
GO:0003697 | single-stranded DNA binding | mollecular_function | IDA |
GO:0003727 | single-stranded RNA binding | mollecular_function | IDA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IDA |
GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
GO:0019834 | phospholipase A2 inhibitor activity | mollecular_function | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IDA |
GO:0004859 | phospholipase inhibitor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0030674 | protein binding, bridging | mollecular_function | IEA |
GO:0005198 | structural molecule activity | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IDA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005929 | cilium | cell_component | IEA |
GO:0016323 | basolateral plasma membrane | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IDA |
GO:0042383 | sarcolemma | cell_component | IEA |
GO:0043234 | protein complex | cell_component | IDA |
GO:0001533 | cornified envelope | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000017469
- Expression info from Arrayexpress [?] : ENSRNOG00000017469
- Protein expression from Protein Atlas: [?] ENSRNOG00000017469
Click on [?] for more information.