TSA1 (Saccharomyces cerevisiae)
Description [+]
- Synonyms: TSA1
- Species: Saccharomyces cerevisiae
- Short gene description: Peroxiredoxin TSA1 (EC 1.11.1.15) (Thioredoxin peroxidase) (Cytoplasmic thiol peroxidase 1) (cTPx 1) (Thiol-specific antioxidant protein 1) (PRP). [Source:UniProtKB/Swiss-Prot;Acc:P34760]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TSA1-S_cerevisiae
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Redoxin | 4 | 160 |
| PFAM A | AhpC-TSA | 5 | 138 |
| PFAM A | 1-cysPrx_C | 148 | 191 |
Protein sequence [+]
TSA1 | Saccharomyces cerevisiae | 4932 | length:196
MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAK
KFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEG
VALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATI
KPTVEDSKEYFEAANK
KFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEG
VALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATI
KPTVEDSKEYFEAANK
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006979 | response to oxidative stress | biological_proccess | IGI |
| GO:0004601 | peroxidase activity | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0008379 | thioredoxin peroxidase activity | mollecular_function | IDA |
| GO:0016209 | antioxidant activity | mollecular_function | IEA |
| GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
| GO:0051082 | unfolded protein binding | mollecular_function | IMP |
| GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
| GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
