ENDOG (Taeniopygia guttata)
Description [+]
- Synonyms: ENDOG
- Species: Taeniopygia guttata
- Short gene description: Endonuclease G, mitochondrial Precursor (Endo G)(EC 3.1.30.-) [Source:UniProtKB/Swiss-Prot;Acc:Q14249]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ENDOG-T_guttata
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Endonuclease_NS | 14 | 215 |
Protein sequence [+]
ENDOG | Taeniopygia guttata | 59729 | length:215
LSKYGLPGLAQLRSRESYVLCYDPRSRSALWVIEQLNRDTLSGSSDRAACDFQEDDSVHE
YHRATNADYRGSGFDRGHLAAAANHKWSQKAMRDTFYLSNIAPQNPHLNQNAWNNLEKYC
RSLAKNNRNVYVCTGPLFLPRMEADGKMYVKYQVIGKNNVAVPTHFFKVLILEKESGEIE
LRSYVMPNSPVDDKIPLERFLVPIESIERASGLLF
YHRATNADYRGSGFDRGHLAAAANHKWSQKAMRDTFYLSNIAPQNPHLNQNAWNNLEKYC
RSLAKNNRNVYVCTGPLFLPRMEADGKMYVKYQVIGKNNVAVPTHFFKVLILEKESGEIE
LRSYVMPNSPVDDKIPLERFLVPIESIERASGLLF
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0001701 | in utero embryonic development | biological_proccess | IEA |
| GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IEA |
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
| GO:0046677 | response to antibiotic | biological_proccess | IEA |
| GO:0034612 | response to tumor necrosis factor | biological_proccess | IEA |
| GO:0003676 | nucleic acid binding | mollecular_function | IEA |
| GO:0016787 | hydrolase activity | mollecular_function | IEA |
| GO:0046872 | metal ion binding | mollecular_function | IEA |
| GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTGUG00000004197
- Expression info from Arrayexpress [?] : ENSTGUG00000004197
- Protein expression from Protein Atlas: [?] ENSTGUG00000004197
Click on [?] for more information.
