ENSTGUG00000006862 (Taeniopygia guttata)
Description [+]
- Synonyms:
- Species: Taeniopygia guttata
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: -T_guttata
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase_Tyr | 1 | 202 |
Protein sequence [+]
| Taeniopygia guttata | 59729 | length:202
HLLPLLGIYQCHGLVGIVTEWMNNGSLHSLIHEHQLYPELPFPLLIRILSDVAEGLHHLH
SLEAALCHCSLKPSNVLLDVQYRAKISDYGLTNWKKQQLRSDLQNCQQRNCQDLVYLPPE
ILEGGLPSQKGDIYSFGILCWESLSRRKPFEGQTNLLDVLRGICSSLRPGISEKFIPSNL
PERNRLLNLIALCWHQEPDYRP
SLEAALCHCSLKPSNVLLDVQYRAKISDYGLTNWKKQQLRSDLQNCQQRNCQDLVYLPPE
ILEGGLPSQKGDIYSFGILCWESLSRRKPFEGQTNLLDVLRGICSSLRPGISEKFIPSNL
PERNRLLNLIALCWHQEPDYRP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0007249 | I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004704 | NF-kappaB-inducing kinase activity | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTGUG00000006862
- Expression info from Arrayexpress [?] : ENSTGUG00000006862
- Protein expression from Protein Atlas: [?] ENSTGUG00000006862
Click on [?] for more information.