ENSTNIG00000005788 (Tetraodon nigroviridis)
Description [+]
- Synonyms:
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Tetraodon nigroviridis
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: -T_nigroviridis
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 87 | 223 |
Protein sequence [+]
| Tetraodon nigroviridis | 99883 | length:225
MKLAEGIKAYISKVTENIISKQTFIEARTMPRLFNTSGSRLGQVTQRPSAHLTLRDTNSL
ARPLSPGFPSLPSPTPGLHQSCRHVVRSWANQSFVGAHLHNMTLTNGQAAGARRTGGYYL
VIPQTFRYPVPRPGRRGPTQRSAQPTQLVPVRSTKRDVLPPSPIQLLKGVGTKCWPDAEY
ALHSVYQGGLFELRAGDELFVSVSSPTMVNADDSSSYFGAFRLDL
ARPLSPGFPSLPSPTPGLHQSCRHVVRSWANQSFVGAHLHNMTLTNGQAAGARRTGGYYL
VIPQTFRYPVPRPGRRGPTQRSAQPTQLVPVRSTKRDVLPPSPIQLLKGVGTKCWPDAEY
ALHSVYQGGLFELRAGDELFVSVSSPTMVNADDSSSYFGAFRLDL
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006936 | muscle contraction | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0003779 | actin binding | mollecular_function | IEA |
GO:0005516 | calmodulin binding | mollecular_function | IEA |
GO:0017022 | myosin binding | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTNIG00000005788
- Expression info from Arrayexpress [?] : ENSTNIG00000005788
- Protein expression from Protein Atlas: [?] ENSTNIG00000005788
Click on [?] for more information.