NP_001033074.1 (Takifugu rubripes)
Description [+]
- Synonyms: NP_001033074.1
- Species: Takifugu rubripes
- Short gene description: tumor necrosis factor alpha [Source:RefSeq_peptide;Acc:NP_001033074]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001033074.1-T_rubripes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 117 | 256 |
Protein sequence [+]
NP_001033074.1 | Takifugu rubripes | 31033 | length:256
MVNYMTTASDVEMGLQQKTVVLVEKKSSTGWMGKIILAIFVVVLCCGGALLFVSYWNGRQ
EMQAVPEKSETLIEKKDTVVVSSSDPHYTLSRISSKAKAAIHLEGSFDEGENRKDQVEWK
NGQGQAFAQGDFQLDNNTIIIPKTGLYFVYSQASFRVTCGEGDKHSPGKSHIPLSHRVWR
YSDSIGTETTLLNAVRSACQNSALEGGYSEGQSCYNAIYLGAVFQLKMGDKLRTETNQLS
ELETEEGKTFFGVFAL
EMQAVPEKSETLIEKKDTVVVSSSDPHYTLSRISSKAKAAIHLEGSFDEGENRKDQVEWK
NGQGQAFAQGDFQLDNNTIIIPKTGLYFVYSQASFRVTCGEGDKHSPGKSHIPLSHRVWR
YSDSIGTETTLLNAVRSACQNSALEGGYSEGQSCYNAIYLGAVFQLKMGDKLRTETNQLS
ELETEEGKTFFGVFAL
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTRUG00000005908
- Expression info from Arrayexpress [?] : ENSTRUG00000005908
- Protein expression from Protein Atlas: [?] ENSTRUG00000005908
- entrezgene: 654303
- refseq_dna: NM_001037985
- refseq_peptide: NP_001033074
Click on [?] for more information.