NP_001106666.1 (Takifugu rubripes)
Description [+]
- Synonyms: NP_001106666.1
- Species: Takifugu rubripes
- Short gene description: MyD88 adaptor [Source:RefSeq_peptide;Acc:NP_001106666]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001106666.1-T_rubripes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Death | 31 | 110 |
PFAM A | TIR | 162 | 291 |
Protein sequence [+]
NP_001106666.1 | Takifugu rubripes | 31033 | length:295
VSTRHVCAASGDVTSALSRVPLLALNMGFRKKVGLYLNPRNAVAADWMALAEALGFTFLE
IKNYESAINPTVKVLEDWQARSTDATVGKLLSILSEVERNDVLEDLQPMIDEDVRRYCER
LNRNPEPPVQVNQVDSCFHRTLERVGLTLHDDPEGTPELFDAFICYCQRDFEFVQEMIRQ
LEETDFKLKLCVFDRDVLPGSCVWTITSELIEKRCKRMVVVISDEYLDSEACDFQTKFAL
SLSPGARNKRLIPVKYKSMSKPFPSILRFLTLCDYTRPCTQAWFWKRLAKALSLP
IKNYESAINPTVKVLEDWQARSTDATVGKLLSILSEVERNDVLEDLQPMIDEDVRRYCER
LNRNPEPPVQVNQVDSCFHRTLERVGLTLHDDPEGTPELFDAFICYCQRDFEFVQEMIRQ
LEETDFKLKLCVFDRDVLPGSCVWTITSELIEKRCKRMVVVISDEYLDSEACDFQTKFAL
SLSPGARNKRLIPVKYKSMSKPFPSILRFLTLCDYTRPCTQAWFWKRLAKALSLP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0031224 | intrinsic to membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTRUG00000017474
- Expression info from Arrayexpress [?] : ENSTRUG00000017474
- Protein expression from Protein Atlas: [?] ENSTRUG00000017474
- entrezgene: 100134853
- refseq_dna: NM_001113195
- refseq_peptide: NP_001106666
Click on [?] for more information.