ASC_BOVIN (Bos taurus)
Description [+]
- Synonyms: ASC_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: Apoptosis-associated speck-like protein containing a CARD (PYD and CARD domain-containing protein) [Source:UniProtKB/Swiss-Prot;Acc:Q8HXK9]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ASC_BOVIN-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | PAAD_DAPIN | 4 | 87 |
PFAM A | CARD | 112 | 195 |
Protein sequence [+]
ASC_BOVIN | Bos taurus | 9913 | length:195
MGCTRDAILDALENLTADEFKKFKMKLLSVPLREGYGRIPRGTLLPLDAVDLTDKLVSYY
LEAYGAELTALVLRDMGMQEVAEQLQETMSKGPRNVLAEVRDPLQKTAKPGLHFVDQHRA
ALIARVTVVDGVLDALYGKVLTEEQYQAVRAERTSSDKMRKLFSFSPAWNMTCKDLLLQA
LRDTQPYLVDDLEQS
LEAYGAELTALVLRDMGMQEVAEQLQETMSKGPRNVLAEVRDPLQKTAKPGLHFVDQHRA
ALIARVTVVDGVLDALYGKVLTEEQYQAVRAERTSSDKMRKLFSFSPAWNMTCKDLLLQA
LRDTQPYLVDDLEQS
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0043281 | regulation of caspase activity | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0050718 | positive regulation of interleukin-1 beta secretion | biological_proccess | IEA |
GO:0033209 | tumor necrosis factor-mediated signaling pathway | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0032090 | Pyrin domain binding | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000020535
- Expression info from Arrayexpress [?] : ENSBTAG00000020535
- Protein expression from Protein Atlas: [?] ENSBTAG00000020535
Click on [?] for more information.