A5PJV7_BOVIN (Bos taurus)
Description [+]
- Synonyms: A5PJV7_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: NGFR protein [Source:UniProtKB/TrEMBL;Acc:A5PJV7]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: A5PJV7_BOVIN-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 35 | 67 |
PFAM A | TNFR_c6 | 70 | 110 |
PFAM A | TNFR_c6 | 112 | 149 |
PFAM A | TNFR_c6 | 152 | 191 |
PFAM A | Death | 348 | 424 |
Protein sequence [+]
A5PJV7_BOVIN | Bos taurus | 9913 | length:430
PMGSGAAGRAMDGPRLLLLLLLLLGVSLGGAKEACLTGLYTHSGECCKACNLGEGVAQPC
GANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDE
TTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQL
RECTRWADAECEEIPGRWITRATPPEGSDSTDPSTQEPEVPPEQDLVTSTVSDVVTTVMG
SSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPE
GEKLHSDSGISVDSQSLHDQQPHTQTAAGQALKGDGGLYSSLPLAKREEVEKLLNGSAGD
TWRHLAGELGYQPEHIDSFTHEACPARALLASWAAQDSATLDTLLAALRRIQRADIVESL
CSESTATSPV
GANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDE
TTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQL
RECTRWADAECEEIPGRWITRATPPEGSDSTDPSTQEPEVPPEQDLVTSTVSDVVTTVMG
SSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPE
GEKLHSDSGISVDSQSLHDQQPHTQTAAGQALKGDGGLYSSLPLAKREEVEKLLNGSAGD
TWRHLAGELGYQPEHIDSFTHEACPARALLASWAAQDSATLDTLLAALRRIQRADIVESL
CSESTATSPV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IEA |
GO:0048146 | positive regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0007411 | axon guidance | biological_proccess | IEA |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0021675 | nerve development | biological_proccess | IEA |
GO:0042488 | positive regulation of odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0016048 | detection of temperature stimulus | biological_proccess | IEA |
GO:0040037 | negative regulation of fibroblast growth factor receptor signaling pathway | biological_proccess | IEA |
GO:0051799 | negative regulation of hair follicle development | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0048406 | nerve growth factor binding | mollecular_function | IEA |
GO:0005035 | death receptor activity | mollecular_function | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000020979
- Expression info from Arrayexpress [?] : ENSBTAG00000020979
- Protein expression from Protein Atlas: [?] ENSBTAG00000020979
- entrezgene: 353110
Click on [?] for more information.