NP_001069866.1 (Bos taurus)
Description [+]
- Synonyms: NP_001069866.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: neurotrophin receptor associated death domain [Source:RefSeq peptide;Acc:NP_001069866]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001069866.1-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Death | 143 | 223 |
Protein sequence [+]
NP_001069866.1 | Bos taurus | 9913 | length:229
MLQNSSHREAMVHVDKTRREQDREGVWAAAGGALAPSTSSPFSPEPPGASGSIIPVYCAL
LATVVLGLLAYVVFKCWRSRKHRQQLAKARTAELGALSRDQLHGDSSVFRDSPAGLEPCA
PSQGPPPELGCRLYLHLPRQQQEEVERLLEVSGEPANGWRGLAGRLGYQAEAVETMARSP
GPASALLRDWAVQEGSGATLRALADALAAMGREDVIRALSSPAEGCSVV
LATVVLGLLAYVVFKCWRSRKHRQQLAKARTAELGALSRDQLHGDSSVFRDSPAGLEPCA
PSQGPPPELGCRLYLHLPRQQQEEVERLLEVSGEPANGWRGLAGRLGYQAEAVETMARSP
GPASALLRDWAVQEGSGATLRALADALAAMGREDVIRALSSPAEGCSVV
Structure links:
- Smartdomain prediction information: SM00005
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
GO:0030027 | lamellipodium | cell_component | IEA |
GO:0005641 | nuclear envelope lumen | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000022598
- Expression info from Arrayexpress [?] : ENSBTAG00000022598
- Protein expression from Protein Atlas: [?] ENSBTAG00000022598
- entrezgene: 615855
- refseq_dna: NM_001076398
- refseq_peptide: NP_001069866
Click on [?] for more information.