PRDX-2 (Caenorhabditis elegans)
Description [+]
- Synonyms: PRDX-2
- Species: Metazoa;Bilateria;Ecdysozoa;Nematoda; Caenorhabditis elegans
- Short gene description: PeRoxireDoXin family member (prdx-2) [Source:RefSeq_peptide;Acc:NP_872052]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX-2-C_elegans
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 9 | 164 |
PFAM A | AhpC-TSA | 10 | 143 |
PFAM A | 1-cysPrx_C | 153 | 196 |
Protein sequence [+]
prdx-2 | Caenorhabditis elegans | 6239 | length:199
MYRQMSKAFIGKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAF
SDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVL
KEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTP
GSDTIKPGVKESQEYFKKH
SDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVL
KEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTP
GSDTIKPGVKESQEYFKKH
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0005515 | protein binding | mollecular_function | IPI |
Check GO Evidence Codes here