NP_001018644.1 (Canis lupus familiaris)
Description [+]
- Synonyms: NP_001018644.1
- Species: Canis lupus familiaris
- Short gene description: BCL2-antagonist/killer 1 [Source:RefSeq_peptide;Acc:NP_001018644]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001018644.1-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2 | 78 | 181 |
Protein sequence [+]
NP_001018644.1 | Canis lupus familiaris | 9615 | length:215
MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASRCHL
FLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGG
WVAALNLGNGPILNVLIVLSVVLLGQFVVRRFFKS
VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASRCHL
FLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGG
WVAALNLGNGPILNVLIVLSVVLLGQFVVRRFFKS
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0048872 | homeostasis of number of cells | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0001974 | blood vessel remodeling | biological_proccess | IEA |
GO:0002262 | myeloid cell homeostasis | biological_proccess | IEA |
GO:0001783 | B cell apoptosis | biological_proccess | IEA |
GO:0009620 | response to fungus | biological_proccess | IEA |
GO:0008053 | mitochondrial fusion | biological_proccess | IEA |
GO:0035108 | limb morphogenesis | biological_proccess | IEA |
GO:0048597 | post-embryonic camera-type eye morphogenesis | biological_proccess | IEA |
GO:0001776 | leukocyte homeostasis | biological_proccess | IEA |
GO:0033137 | negative regulation of peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IEA |
GO:0002352 | B cell negative selection | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IEA |
GO:0010046 | response to mycotoxin | biological_proccess | IEA |
GO:0010524 | positive regulation of calcium ion transport into cytosol | biological_proccess | IEA |
GO:0032471 | reduction of endoplasmic reticulum calcium ion concentration | biological_proccess | IEA |
GO:0060068 | vagina development | biological_proccess | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000001022
- Expression info from Arrayexpress [?] : ENSCAFG00000001022
- Protein expression from Protein Atlas: [?] ENSCAFG00000001022
- entrezgene: 481744
- refseq_dna: NM_001020808
- refseq_peptide: NP_001018644
Click on [?] for more information.