AN32A_CANFA (Canis lupus familiaris)
Description [+]
- Synonyms: AN32A_CANFA
- Species: Canis lupus familiaris
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: AN32A_CANFA-C_familiaris
Structure & Sequence [+]
Protein sequence [+]
AN32A_CANFA | Canis lupus familiaris | 9615 | length:249
MDMDKRIHLELRNRTPSDVKELVLDNCRSIEGKIEGLTDEFEELEFLSTINVGLTSVANL
PKLNKLKKLELSDNRISGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDDEEDEDEEEYD
EDAQVVEDEEDEEEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEDVGEEERGQKRKRE
PEDEGEDDD
PKLNKLKKLELSDNRISGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDDEEDEDEEEYD
EDAQVVEDEEDEEEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEDVGEEERGQKRKRE
PEDEGEDDD
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006350 | transcription | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006913 | nucleocytoplasmic transport | biological_proccess | ISS |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | ISS |
GO:0016363 | nuclear matrix | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | ISS |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000017502
- Expression info from Arrayexpress [?] : ENSCAFG00000017502
- Protein expression from Protein Atlas: [?] ENSCAFG00000017502
- entrezgene: 403534
- refseq_dna: NM_001003013
- refseq_peptide: NP_001003013
Click on [?] for more information.