TNFRSF4 (Canis lupus familiaris)
Description [+]
- Synonyms: TNFRSF4
- Species: Canis lupus familiaris
- Short gene description: Tumor necrosis factor receptor superfamily member 4 Precursor (OX40L receptor)(ACT35 antigen)(TAX transcriptionally-activated glycoprotein 1 receptor)(CD134 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P43489]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF4-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 66 | 106 |
Protein sequence [+]
TNFRSF4 | Canis lupus familiaris | 9615 | length:274
MFVESLRLSGPHSALLLLGLVLGAVAEHNCFGNTYPKDGKCCNDCPPGYGMESRCSRSHD
TKCHQCPSGFYNEATNYEPCKPCTQCNQRSGSEPKRRCTPTQDTICSCKPGTEPRDGYKR
GVDCAPCPPGHFSPGDDQACKPWTKLYLMKRRTMQPASKSSDAVCEDRSLPATLPWETQS
PLTRPPTPQPTMAWPRTSQGPFTPPTEPPRGPQLAAVLGLGLGLLAPVAAALALLLHHRA
WRLPPALSSSPGGNSFRTPIQEEHADANSTLAKI
TKCHQCPSGFYNEATNYEPCKPCTQCNQRSGSEPKRRCTPTQDTICSCKPGTEPRDGYKR
GVDCAPCPPGHFSPGDDQACKPWTKLYLMKRRTMQPASKSSDAVCEDRSLPATLPWETQS
PLTRPPTPQPTMAWPRTSQGPFTPPTEPPRGPQLAAVLGLGLGLLAPVAAALALLLHHRA
WRLPPALSSSPGGNSFRTPIQEEHADANSTLAKI
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | IEA |
GO:0045859 | regulation of protein kinase activity | biological_proccess | IEA |
GO:0006968 | cellular defense response | biological_proccess | IEA |
GO:0050710 | negative regulation of cytokine secretion | biological_proccess | IEA |
GO:0051024 | positive regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0043433 | negative regulation of transcription factor activity | biological_proccess | IEA |
GO:0032582 | negative regulation of gene-specific transcription | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000019328
- Expression info from Arrayexpress [?] : ENSCAFG00000019328
- Protein expression from Protein Atlas: [?] ENSCAFG00000019328
- entrezgene: 489600
Click on [?] for more information.