TNFRSF14 (Canis lupus familiaris)
Description [+]
- Synonyms: TNFRSF14
- Species: Canis lupus familiaris
- Short gene description: Tumor necrosis factor receptor superfamily member 14 Precursor (Herpesvirus entry mediator A)(Tumor necrosis factor receptor-like 2)(TR2) [Source:UniProtKB/Swiss-Prot;Acc:Q92956]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF14-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 78 | 119 |
Protein sequence [+]
TNFRSF14 | Canis lupus familiaris | 9615 | length:311
MGPLRGWELPPWSQAPKADALSQALYLLLLGSLPWALATAPCKEEEYPVGSECCPKCSPG
YRVKEACGELTGTVCAPCDPGTYTAHLNGLSECLQCRMCDPAMALVTRQKCSRTENTVCA
CAQGHFCISENEDDCVECRPHTPCKPGQRVVARGTEQRDTMCEDCPPGTFSPNGTLEQCQ
PWTMCSGPFQREAHAGTSSSDVTCSSWGPPLMSSFLGIFVLLVLISLCFWMKRRRQHACV
SWVLTLGPRLQAGLGDPGSERVAMVPQAPPDVTTVAMEETASMPPAGDSSRMQMSQPSWA
MPAGSCQAPQG
YRVKEACGELTGTVCAPCDPGTYTAHLNGLSECLQCRMCDPAMALVTRQKCSRTENTVCA
CAQGHFCISENEDDCVECRPHTPCKPGQRVVARGTEQRDTMCEDCPPGTFSPNGTLEQCQ
PWTMCSGPFQREAHAGTSSSDVTCSSWGPPLMSSFLGIFVLLVLISLCFWMKRRRQHACV
SWVLTLGPRLQAGLGDPGSERVAMVPQAPPDVTTVAMEETASMPPAGDSSRMQMSQPSWA
MPAGSCQAPQG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | biological_proccess | IEA |
GO:0046642 | negative regulation of alpha-beta T cell proliferation | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000019422
- Expression info from Arrayexpress [?] : ENSCAFG00000019422
- Protein expression from Protein Atlas: [?] ENSCAFG00000019422
Click on [?] for more information.