ZGC:158862 (Danio rerio)
Description [+]
- Synonyms: ZGC:158862
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: hypothetical protein LOC100009628 [Source:RefSeq_peptide;Acc:NP_001076466]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ZGC:158862-D_rerio
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 60 | 101 |
Protein sequence [+]
zgc:158862 | Danio rerio | 7955 | length:248
MTIVGTGILLVVFCTLPGFGDACGPSEYKSAAGECCPMCSVGSIVRSDCSGDLSTTCKPC
PSGTFMNEPNGLHNCFPCRNCAEDHGLYIKSKCTTMQDSICDVLDDHYCIEFLNQQCSRA
IRHSVCKAGQETKTQGTKTTDTVCVDCTHGFFSPSGLKCIKWLNCTALNEMQTEDGSSVK
DVTCRPTRGRYGLLCGVTLVGVTMFFFISLCWFQPNNSNGQANLNVQHPIQETISSSTPE
NINEQRNI
PSGTFMNEPNGLHNCFPCRNCAEDHGLYIKSKCTTMQDSICDVLDDHYCIEFLNQQCSRA
IRHSVCKAGQETKTQGTKTTDTVCVDCTHGFFSPSGLKCIKWLNCTALNEMQTEDGSSVK
DVTCRPTRGRYGLLCGVTLVGVTMFFFISLCWFQPNNSNGQANLNVQHPIQETISSSTPE
NINEQRNI
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0008150 | biological_process | biological_proccess | ND |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005575 | cellular_component | cell_component | ND |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-070209-146
- Ensembl genome browser [?] : ENSDARG00000068963
- Expression info from Arrayexpress [?] : ENSDARG00000068963
- Protein expression from Protein Atlas: [?] ENSDARG00000068963
- Community gene edition from Wikigenes: [?] 796016
- entrezgene: 796016
- entrezgene: 100009628
- refseq_dna: NM_001082997
- refseq_peptide: NP_001076466
Click on [?] for more information.