TNFA_HORSE (Equus caballus)
Description [+]
- Synonyms: TNFA_HORSE
- Species: Equus caballus
- Short gene description: Tumor necrosis factor precursor (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) (Cachectin) [Contains: Tumor necrosis factor, membrane form; Tumor necrosis factor, soluble form]. [Source:UniProtKB/Swiss-Prot;Acc:P29553]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFA_HORSE-E_caballus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 103 | 234 |
Protein sequence [+]
TNFA_HORSE | Equus caballus | 9796 | length:234
MSTESMIRDVELAEEELAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEQLPNAFQSINPLAQTLRSSSRTPSDKPVAHVVANPQAEGQLQWLSGRANALLANGVKL
TDNQLVVPLDGLYLIYSQVLFKGQGCPSTHVLLTHTISRLAVSYPSKVNLLSAIKSPCHT
ESPEQAEAKPWYEPIYLGGVFQLEKGDQLSAEINQPNYLDFAESGQVYFGIIAL
EEQLPNAFQSINPLAQTLRSSSRTPSDKPVAHVVANPQAEGQLQWLSGRANALLANGVKL
TDNQLVVPLDGLYLIYSQVLFKGQGCPSTHVLLTHTISRLAVSYPSKVNLLSAIKSPCHT
ESPEQAEAKPWYEPIYLGGVFQLEKGDQLSAEINQPNYLDFAESGQVYFGIIAL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0000187 | activation of MAPK activity | biological_proccess | IEA |
GO:0001932 | regulation of protein amino acid phosphorylation | biological_proccess | IEA |
GO:0001934 | positive regulation of protein amino acid phosphorylation | biological_proccess | IEA |
GO:0002439 | chronic inflammatory response to antigenic stimulus | biological_proccess | IEA |
GO:0002740 | negative regulation of cytokine secretion during immune response | biological_proccess | IEA |
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0006927 | transformed cell apoptosis | biological_proccess | IEA |
GO:0006952 | defense response | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006959 | humoral immune response | biological_proccess | IEA |
GO:0007254 | JNK cascade | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0009615 | response to virus | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0016481 | negative regulation of transcription | biological_proccess | IEA |
GO:0030316 | osteoclast differentiation | biological_proccess | IEA |
GO:0032715 | negative regulation of interleukin-6 production | biological_proccess | IEA |
GO:0032722 | positive regulation of chemokine production | biological_proccess | IEA |
GO:0032800 | receptor biosynthetic process | biological_proccess | IEA |
GO:0033209 | tumor necrosis factor-mediated signaling pathway | biological_proccess | IEA |
GO:0034116 | positive regulation of heterotypic cell-cell adhesion | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0042346 | positive regulation of NF-kappaB import into nucleus | biological_proccess | IEA |
GO:0042742 | defense response to bacterium | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0043193 | positive regulation of gene-specific transcription | biological_proccess | IEA |
GO:0045071 | negative regulation of viral genome replication | biological_proccess | IEA |
GO:0045080 | positive regulation of chemokine biosynthetic process | biological_proccess | IEA |
GO:0045123 | cellular extravasation | biological_proccess | IEA |
GO:0045429 | positive regulation of nitric oxide biosynthetic process | biological_proccess | IEA |
GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0045941 | positive regulation of transcription | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0045994 | positive regulation of translational initiation by iron | biological_proccess | IEA |
GO:0046325 | negative regulation of glucose import | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0048661 | positive regulation of smooth muscle cell proliferation | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IEA |
GO:0050796 | regulation of insulin secretion | biological_proccess | IEA |
GO:0050900 | leukocyte migration | biological_proccess | IEA |
GO:0050901 | leukocyte tethering or rolling | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0051798 | positive regulation of hair follicle development | biological_proccess | IEA |
GO:0032755 | positive regulation of interleukin-6 production | biological_proccess | IEA |
GO:0051044 | positive regulation of membrane protein ectodomain proteolysis | biological_proccess | IEA |
GO:0050995 | negative regulation of lipid catabolic process | biological_proccess | IEA |
GO:0030730 | sequestering of triglyceride | biological_proccess | IEA |
GO:0060559 | biological_proccess | IEA | |
GO:0060557 | biological_proccess | IEA | |
GO:0060555 | biological_proccess | IEA | |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0001891 | phagocytic cup | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0055037 | recycling endosome | cell_component | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000001174
- Expression info from Arrayexpress [?] : ENSECAG00000001174
- Protein expression from Protein Atlas: [?] ENSECAG00000001174
- Community gene edition from Wikigenes: [?] 100033834
- entrezgene: 100033834
- refseq_peptide: NP_001075288
Click on [?] for more information.