NP_001026133.1 (Gallus gallus)
Description [+]
- Synonyms: NP_001026133.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: myeloid differentiation primary response gene (88) [Source:RefSeq_peptide;Acc:NP_001026133]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001026133.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TIR | 113 | 236 |
Protein sequence [+]
NP_001026133.1 | Gallus gallus | 9031 | length:322
EKLGHDYLEIRRLEALPDPTAALLEEWQSRCPGGATVGQLLELLRQLGRHDVLLELGGSV
EEDCKKYLRRKQQEAEQPLQVPAVDSSVPKTSELMGITTRDDPYGHGTEMFDAFICYCQK
DLQFVQEMIRELEQTEFKLKLCVFDRDVLPGTCVWSISGELIERRCRRMVVVISDDYLES
DECDFQTKFALSLSPGARLKRLIPVKCKTMKNEFPSILRFITICDYTNPCTKMVLDKTGK
ISLAAVMQSFESFFSICPGCAFGPRCSYSISLQNVDPRSQRLEPAAGSKEFSVALFHNLE
GEIEQLCGCSYLIQRAIASSTW
EEDCKKYLRRKQQEAEQPLQVPAVDSSVPKTSELMGITTRDDPYGHGTEMFDAFICYCQK
DLQFVQEMIRELEQTEFKLKLCVFDRDVLPGTCVWSISGELIERRCRRMVVVISDDYLES
DECDFQTKFALSLSPGARLKRLIPVKCKTMKNEFPSILRFITICDYTNPCTKMVLDKTGK
ISLAAVMQSFESFFSICPGCAFGPRCSYSISLQNVDPRSQRLEPAAGSKEFSVALFHNLE
GEIEQLCGCSYLIQRAIASSTW
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0002238 | response to molecule of fungal origin | biological_proccess | IEA |
GO:0002755 | MyD88-dependent toll-like receptor signaling pathway | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0009615 | response to virus | biological_proccess | IEA |
GO:0016064 | immunoglobulin mediated immune response | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0032760 | positive regulation of tumor necrosis factor production | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0045080 | positive regulation of chemokine biosynthetic process | biological_proccess | IEA |
GO:0045351 | type I interferon biosynthetic process | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0031224 | intrinsic to membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000005947
- Expression info from Arrayexpress [?] : ENSGALG00000005947
- Protein expression from Protein Atlas: [?] ENSGALG00000005947
- entrezgene: 420420
- refseq_dna: NM_001030962
- refseq_peptide: NP_001026133
Click on [?] for more information.