NP_001006534.1 (Gallus gallus)
Description [+]
- Synonyms: NP_001006534.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: SH3-domain GRB2-like endophilin B1 [Source:RefSeq_peptide;Acc:NP_001006534]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001006534.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BAR | 14 | 257 |
PFAM A | SH3_1 | 312 | 368 |
PFAM A | SH3_2 | 313 | 368 |
Protein sequence [+]
NP_001006534.1 | Gallus gallus | 9031 | length:369
PPKMNIMDFNMKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKQWTE
KIMKQTEVLLQPNPNARIEEFFYEKLDRKAPSRMNNPELLGQYMIDAGNEFGPGTAYGNA
LIKCGETQKQIGTADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKT
RLKKAKVAEARAASEQEVRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTY
YAQCYKYMLDLQKQLGSFPSTFLSNNNQSSSAPVQSVSTPSVLASASASLPSVSNSVVTS
GISELKSSSGSRKARVLYDYDAANSSELSLLADEVITVYSIPGMDSDWLMGERGNQKGKV
PITYLELLN
KIMKQTEVLLQPNPNARIEEFFYEKLDRKAPSRMNNPELLGQYMIDAGNEFGPGTAYGNA
LIKCGETQKQIGTADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKT
RLKKAKVAEARAASEQEVRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTY
YAQCYKYMLDLQKQLGSFPSTFLSNNNQSSSAPVQSVSTPSVLASASASLPSVSNSVVTS
GISELKSSSGSRKARVLYDYDAANSSELSLLADEVITVYSIPGMDSDWLMGERGNQKGKV
PITYLELLN
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001844 | protein insertion into mitochondrial membrane during induction of apoptosis | biological_proccess | IEA |
GO:0006654 | phosphatidic acid biosynthetic process | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0008654 | phospholipid biosynthetic process | biological_proccess | IEA |
GO:0051084 | 'de novo' posttranslational protein folding | biological_proccess | IEA |
GO:0005504 | fatty acid binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008289 | lipid binding | mollecular_function | IEA |
GO:0042171 | lysophosphatidic acid acyltransferase activity | mollecular_function | IEA |
GO:0000139 | Golgi membrane | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005741 | mitochondrial outer membrane | cell_component | IEA |
GO:0005792 | microsome | cell_component | IEA |
GO:0005794 | Golgi apparatus | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0043234 | protein complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000006284
- Expression info from Arrayexpress [?] : ENSGALG00000006284
- Protein expression from Protein Atlas: [?] ENSGALG00000006284
- entrezgene: 424522
- refseq_dna: NM_001006534
- refseq_peptide: NP_001006534
Click on [?] for more information.