NP_990197.1 (Gallus gallus)
Description [+]
- Synonyms: NP_990197.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: BCL2-related protein A1 [Source:RefSeq_peptide;Acc:NP_990197]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_990197.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2 | 37 | 140 |
Protein sequence [+]
NP_990197.1 | Gallus gallus | 9031 | length:174
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRID
ITSVDVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEKISY
FITEYIINNKAAWIDANGGWENGFLTKFERRSPLSFSTITDIFAAVLSLFREYH
ITSVDVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEKISY
FITEYIINNKAAWIDANGGWENGFLTKFERRSPLSFSTITDIFAAVLSLFREYH
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000006511
- Expression info from Arrayexpress [?] : ENSGALG00000006511
- Protein expression from Protein Atlas: [?] ENSGALG00000006511
Click on [?] for more information.