FADD (Gallus gallus)
Description [+]
- Synonyms: FADD
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: Protein FADD (FAS-associated death domain protein)(FAS-associating death domain-containing protein)(Mediator of receptor induced toxicity) [Source:UniProtKB/Swiss-Prot;Acc:Q13158]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: FADD-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | DED | 1 | 79 |
PFAM A | Death | 96 | 179 |
Protein sequence [+]
FADD | Gallus gallus | 9031 | length:185
NSLSASLSSSELCELKFLCKDKIGKRKLESVQSGRELFNFLMEQQLIASYNVDLLKSMFK
TIKREDLISQLEEFIEEGEASAPDERPDMKERRLQKVVIEVICENVGRDWKMLMRKLDFS
DVRMERIMVAKPNNLREQLFQSLREWQKWKGKDAKVADLIKALRDCNMNLVADIAEQKLF
HLNTE
TIKREDLISQLEEFIEEGEASAPDERPDMKERRLQKVVIEVICENVGRDWKMLMRKLDFS
DVRMERIMVAKPNNLREQLFQSLREWQKWKGKDAKVADLIKALRDCNMNLVADIAEQKLF
HLNTE
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0070265 | necrotic cell death | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0031264 | death-inducing signaling complex | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000007625
- Expression info from Arrayexpress [?] : ENSGALG00000007625
- Protein expression from Protein Atlas: [?] ENSGALG00000007625
Click on [?] for more information.