NGFR (Homo sapiens)
Description [+]
- Synonyms: NGFR
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor receptor superfamily member 16 Precursor (Low-affinity nerve growth factor receptor)(NGF receptor)(Gp80-LNGFR)(p75 ICD)(Low affinity neurotrophin receptor p75NTR)(CD271 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P08138]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NGFR-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 32 | 64 |
PFAM A | TNFR_c6 | 67 | 107 |
PFAM A | TNFR_c6 | 109 | 146 |
PFAM A | TNFR_c6 | 149 | 188 |
PFAM A | Death | 345 | 421 |
Protein sequence [+]
NGFR | Homo sapiens | 9606 | length:427
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
Structure links:
- Smartdomain prediction information: SM00208
- Smartdomain prediction information: SM00005
- Prosite motif and domain information: PS00120
- Prosite motif and domain information: PS00652
- Prosite motif and domain information: PS01186
- Profile motif and domain profile information: PS50311
- Profile motif and domain profile information: PS50017
- Profile motif and domain profile information: PS50050
- Interpro domain information: P08138
- PFAM domain and domain family information: P08138
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007411 | axon guidance | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0009611 | response to wounding | biological_proccess | IEA |
GO:0016048 | detection of temperature stimulus | biological_proccess | IEA |
GO:0021675 | nerve development | biological_proccess | IEA |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0040037 | negative regulation of fibroblast growth factor receptor signaling pathway | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0048146 | positive regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0051799 | negative regulation of hair follicle development | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IEA |
GO:0042488 | positive regulation of odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0048635 | negative regulation of muscle development | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0030154 | cell differentiation | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0005030 | neurotrophin receptor activity | mollecular_function | IEA |
GO:0005035 | death receptor activity | mollecular_function | IEA |
GO:0048406 | nerve growth factor binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | TAS |
GO:0005886 | plasma membrane | cell_component | TAS |
GO:0005886 | plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :7809
- Gene related info from GeneCards [?] : NGFR
- Ensembl genome browser [?] : ENSG00000064300
- Expression info from Arrayexpress [?] : ENSG00000064300
- Protein expression from Protein Atlas: [?] ENSG00000064300
- Community gene edition from Wikigenes: [?] 4804
- OMIM gene information: 162010
- OMIM disease information:
Click on [?] for more information.