MAPK12 (Homo sapiens)
Description [+]
- Synonyms: MAPK12
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Mitogen-activated protein kinase 12 (EC 2.7.11.24)(Extracellular signal-regulated kinase 6)(ERK-6)(ERK5)(Stress-activated protein kinase 3)(Mitogen-activated protein kinase p38 gamma)(MAP kinase p38 gamma) [Source:UniProtKB/Swiss-Prot;Acc:P53778]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK12-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 27 | 311 |
PFAM A | Pkinase_Tyr | 27 | 253 |
Protein sequence [+]
MAPK12 | Homo sapiens | 9606 | length:367
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
Structure links:
- Smartdomain prediction information: SM00219
- Smartdomain prediction information: SM00220
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS01351
- Profile motif and domain profile information: PS50011
- Interpro domain information: P53778
- PFAM domain and domain family information: P53778
- Protein 3D structures from PDB: 1CM8
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0006975 | DNA damage induced protein phosphorylation | biological_proccess | TAS |
GO:0007050 | cell cycle arrest | biological_proccess | TAS |
GO:0007242 | intracellular signaling cascade | biological_proccess | EXP |
GO:0007265 | Ras protein signal transduction | biological_proccess | EXP |
GO:0007517 | muscle development | biological_proccess | TAS |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0045445 | myoblast differentiation | biological_proccess | IDA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | TAS |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0000287 | magnesium ion binding | mollecular_function | IDA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :6874
- Gene related info from GeneCards [?] : MAPK12
- Ensembl genome browser [?] : ENSG00000188130
- Expression info from Arrayexpress [?] : ENSG00000188130
- Protein expression from Protein Atlas: [?] ENSG00000188130
- Community gene edition from Wikigenes: [?] 6300
- OMIM gene information: 602399
- OMIM disease information:
Click on [?] for more information.