ANP32D (Homo sapiens)
Description [+]
- Synonyms: ANP32D
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Acidic leucine-rich nuclear phosphoprotein 32 family member D (Phosphoprotein 32-related protein 2)(Tumorigenic protein pp32r2) [Source:UniProtKB/Swiss-Prot;Acc:O95626]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANP32D-H_sapiens
Structure & Sequence [+]
Protein sequence [+]
ANP32D | Homo sapiens | 9606 | length:131
MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANL
PKLNKLKKLELSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDL
FTCEVTNLNNY
PKLNKLKKLELSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDL
FTCEVTNLNNY
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0016363 | nuclear matrix | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :16676
- Gene related info from GeneCards [?] : ANP32D
- Ensembl genome browser [?] : ENSG00000139223
- Expression info from Arrayexpress [?] : ENSG00000139223
- Protein expression from Protein Atlas: [?] ENSG00000139223
- Community gene edition from Wikigenes: [?] 23519
- OMIM gene information: 606878
- OMIM disease information:
Click on [?] for more information.