TNFRSF11B (Homo sapiens)
Description [+]
- Synonyms: TNFRSF11B
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor receptor superfamily member 11B Precursor (Osteoprotegerin)(Osteoclastogenesis inhibitory factor) [Source:UniProtKB/Swiss-Prot;Acc:O00300]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF11B-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 65 | 105 |
PFAM A | Death | 279 | 365 |
Protein sequence [+]
TNFRSF11B | Homo sapiens | 9606 | length:401
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT
VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK
HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT
HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT
VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK
HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT
HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT
VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0030198 | extracellular matrix organization | biological_proccess | IEA |
GO:0042489 | negative regulation of odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0001501 | skeletal system development | biological_proccess | TAS |
GO:0007165 | signal transduction | biological_proccess | TAS |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007584 | response to nutrient | biological_proccess | IEA |
GO:0032026 | response to magnesium ion | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0043627 | response to estrogen stimulus | biological_proccess | IEA |
GO:0046685 | response to arsenic | biological_proccess | IEA |
GO:0045779 | negative regulation of bone resorption | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | TAS |
GO:0005125 | cytokine activity | mollecular_function | TAS |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005578 | proteinaceous extracellular matrix | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | TAS |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :11909
- Gene related info from GeneCards [?] : TNFRSF11B
- Ensembl genome browser [?] : ENSG00000164761
- Expression info from Arrayexpress [?] : ENSG00000164761
- Protein expression from Protein Atlas: [?] ENSG00000164761
- Community gene edition from Wikigenes: [?] 4982
Click on [?] for more information.