ANP32B (Homo sapiens)
Description [+]
- Synonyms: ANP32B
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Acidic leucine-rich nuclear phosphoprotein 32 family member B (Acidic protein rich in leucines)(PHAPI2)(Silver-stainable protein SSP29) [Source:UniProtKB/Swiss-Prot;Acc:Q92688]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANP32B-H_sapiens
Structure & Sequence [+]
Protein sequence [+]
ANP32B | Homo sapiens | 9606 | length:251
MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL
PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL
FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDE
DDEDGEEEEFDEEDDEDEDVEGDEDDDEVSEEEEEFGLDEEDEDEDEDEEEEEGGKGEKR
KRETDDEGEDD
PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL
FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDE
DDEDGEEEEFDEEDDEDEDVEGDEDDDEVSEEEEEFGLDEEDEDEDEDEEEEEGGKGEKR
KRETDDEGEDD
Structure links:
- Smartdomain prediction information: SM00369
- Smartdomain prediction information: SM00446
- Profile motif and domain profile information: PS50312
- Profile motif and domain profile information: PS50313
- Interpro domain information: Q92688
- PFAM domain and domain family information: Q92688
- Protein 3D structures from PDB: 2ELL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :16677
- Gene related info from GeneCards [?] : ANP32B
- Ensembl genome browser [?] : ENSG00000136938
- Expression info from Arrayexpress [?] : ENSG00000136938
- Protein expression from Protein Atlas: [?] ENSG00000136938
- Community gene edition from Wikigenes: [?] 10541
Click on [?] for more information.