TNFRSF25 (Homo sapiens)
Description [+]
- Synonyms: TNFRSF25
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor receptor superfamily member 25 Precursor (WSL-1 protein)(Apoptosis-mediating receptor DR3)(Apoptosis-mediating receptor TRAMP)(Death domain receptor 3)(WSL protein)(Apoptosis-inducing receptor AIR)(Apo-3)(Lymphocyte-associated receptor of death)(LARD) [Source:UniProtKB/Swiss-Prot;Acc:Q93038]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF25-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Death | 342 | 422 |
Protein sequence [+]
TNFRSF25 | Homo sapiens | 9606 | length:426
MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAP
CTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPG
WFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCP
TPPPSLAGAPWGAVQSAVPLSVAGGRVGVFWVQVLLAGLVVPLLLGATLTYTYRHCWPHK
PLVTADEAGMEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNSWTPGYPETQEA
LCPQVTWSWDQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEFV
RTLGLREAEIEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRS
RLQRGP
CTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPG
WFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCP
TPPPSLAGAPWGAVQSAVPLSVAGGRVGVFWVQVLLAGLVVPLLLGATLTYTYRHCWPHK
PLVTADEAGMEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNSWTPGYPETQEA
LCPQVTWSWDQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEFV
RTLGLREAEIEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRS
RLQRGP
Structure links:
- Smartdomain prediction information: SM00208
- Smartdomain prediction information: SM00005
- Prosite motif and domain information: PS00652
- Prosite motif and domain information: PS01186
- Profile motif and domain profile information: PS50311
- Profile motif and domain profile information: PS50017
- Profile motif and domain profile information: PS50050
- Interpro domain information: Q93038
- PFAM domain and domain family information: Q93038
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | TAS |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | TAS |
GO:0042981 | regulation of apoptosis | biological_proccess | NAS |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | TAS |
GO:0004872 | receptor activity | mollecular_function | NAS |
GO:0016020 | membrane | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | TAS |
GO:0005886 | plasma membrane | cell_component | IDA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005829 | cytosol | cell_component | NAS |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :11910
- Gene related info from GeneCards [?] : TNFRSF25
- Ensembl genome browser [?] : ENSG00000215788
- Expression info from Arrayexpress [?] : ENSG00000215788
- Protein expression from Protein Atlas: [?] ENSG00000215788
- Community gene edition from Wikigenes: [?] 8718
- OMIM gene information: 603366
- OMIM disease information:
- entrezgene: 8718
- refseq_dna: NM_001039664
- refseq_dna: NM_148965
- refseq_dna: NM_003790
- refseq_dna: NM_148966
- refseq_dna: NM_148967
- refseq_dna: NM_148970
- refseq_peptide: NP_001034753
- refseq_peptide: NP_683866
- refseq_peptide: NP_003781
- refseq_peptide: NP_683867
- refseq_peptide: NP_683868
- refseq_peptide: NP_683871
Click on [?] for more information.