HTRA2 (Monodelphis domestica)
Description [+]
- Synonyms: HTRA2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Metatheria; Monodelphis domestica
- Short gene description: Serine protease HTRA2, mitochondrial Precursor (EC 3.4.21.108)(High temperature requirement protein A2)(HtrA2)(Omi stress-regulated endoprotease)(Serine proteinase OMI)(Serine protease 25) [Source:UniProtKB/Swiss-Prot;Acc:O43464]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: HTRA2-M_domestica
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Trypsin | 68 | 244 |
Protein sequence [+]
HTRA2 | Monodelphis domestica | 13616 | length:360
RARRWAAAAMGAGAAAALLLLWGSGGRGPPAVLAAVPTPPSSSSPRRLYNFIADVVEKTA
PAVVYIEILGRHPFSGREVPISNGSGFIVASDGLIVTNAHVVADRRRVRVRLPSGETYEA
TVTAVDPVADIATLRIPTKEPLPTLPLGRSAEVRQGEFVVAMGSPFALQNTITSGIVSSA
QRRARDLGLPQPNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRL
REFLQRGGKKSSWFGTSESKRRYIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVIL
GSPAHRAGLRPGDIILCIGDRLVKSAEDVYEAVRTQAKLAVQVRRGLDTLTLFVIPEVTE
PAVVYIEILGRHPFSGREVPISNGSGFIVASDGLIVTNAHVVADRRRVRVRLPSGETYEA
TVTAVDPVADIATLRIPTKEPLPTLPLGRSAEVRQGEFVVAMGSPFALQNTITSGIVSSA
QRRARDLGLPQPNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRL
REFLQRGGKKSSWFGTSESKRRYIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVIL
GSPAHRAGLRPGDIILCIGDRLVKSAEDVYEAVRTQAKLAVQVRRGLDTLTLFVIPEVTE
Structure links:
- Smartdomain prediction information: SM00228
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0040014 | regulation of multicellular organism growth | biological_proccess | IEA |
GO:0007628 | adult walking behavior | biological_proccess | IEA |
GO:0007005 | mitochondrion organization | biological_proccess | IEA |
GO:0030900 | forebrain development | biological_proccess | IEA |
GO:0048666 | neuron development | biological_proccess | IEA |
GO:0008344 | adult locomotory behavior | biological_proccess | IEA |
GO:0008629 | induction of apoptosis by intracellular signals | biological_proccess | IEA |
GO:0004252 | serine-type endopeptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008236 | serine-type peptidase activity | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005758 | mitochondrial intermembrane space | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMODG00000004817
- Expression info from Arrayexpress [?] : ENSMODG00000004817
- Protein expression from Protein Atlas: [?] ENSMODG00000004817
Click on [?] for more information.