NGFR (Monodelphis domestica)
Description [+]
- Synonyms: NGFR
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Metatheria; Monodelphis domestica
- Short gene description: Tumor necrosis factor receptor superfamily member 16 Precursor (Low-affinity nerve growth factor receptor)(NGF receptor)(Gp80-LNGFR)(p75 ICD)(Low affinity neurotrophin receptor p75NTR)(CD271 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P08138]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NGFR-M_domestica
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 32 | 64 |
PFAM A | TNFR_c6 | 67 | 107 |
PFAM A | TNFR_c6 | 109 | 146 |
PFAM A | TNFR_c6 | 149 | 188 |
PFAM A | Death | 347 | 423 |
Protein sequence [+]
NGFR | Monodelphis domestica | 13616 | length:429
PTYPAMEGPYRLLLMLLLLLLGVSMGEVKEDCATDLYTDSGECCRACNQGEGVAQPCGVN
QTVCEPCLDSVTFSDTVSATEACKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDEESG
ICKPCSVCEPGSGLVFSCQDKQNTVCEVCPEGTYSDEANHVDPCLPCTACEETEREIREC
TRWSDRECEEIPARWIPRTTTTTIVGSESPAPVTQEPPEPPEPEAEASTVADVVTTVMGS
SQPVVTRGTTDNLIPVYCSILAAVVVGLLAYIVFKRWNSCKQNKQGANNRPVNQTPSPEG
EKLHSDSGISVDSQSLHDQQPQTQTAQVQALKGDGGLYSNLPAAKREEVEKLLNSSSEET
WRHLAGELGYLPERIDSLTREDYPVRALLDSWAAQDSATLDALYAALRRIQRGDIVENLY
SESTATSPV
QTVCEPCLDSVTFSDTVSATEACKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDEESG
ICKPCSVCEPGSGLVFSCQDKQNTVCEVCPEGTYSDEANHVDPCLPCTACEETEREIREC
TRWSDRECEEIPARWIPRTTTTTIVGSESPAPVTQEPPEPPEPEAEASTVADVVTTVMGS
SQPVVTRGTTDNLIPVYCSILAAVVVGLLAYIVFKRWNSCKQNKQGANNRPVNQTPSPEG
EKLHSDSGISVDSQSLHDQQPQTQTAQVQALKGDGGLYSNLPAAKREEVEKLLNSSSEET
WRHLAGELGYLPERIDSLTREDYPVRALLDSWAAQDSATLDALYAALRRIQRGDIVENLY
SESTATSPV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IEA |
GO:0048146 | positive regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0007411 | axon guidance | biological_proccess | IEA |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0021675 | nerve development | biological_proccess | IEA |
GO:0042488 | positive regulation of odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0016048 | detection of temperature stimulus | biological_proccess | IEA |
GO:0040037 | negative regulation of fibroblast growth factor receptor signaling pathway | biological_proccess | IEA |
GO:0051799 | negative regulation of hair follicle development | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0048406 | nerve growth factor binding | mollecular_function | IEA |
GO:0005035 | death receptor activity | mollecular_function | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMODG00000012200
- Expression info from Arrayexpress [?] : ENSMODG00000012200
- Protein expression from Protein Atlas: [?] ENSMODG00000012200
Click on [?] for more information.