CD40 (Monodelphis domestica)
Description [+]
- Synonyms: CD40
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Metatheria; Monodelphis domestica
- Short gene description: Tumor necrosis factor receptor superfamily member 5 Precursor (CD40L receptor)(B-cell surface antigen CD40)(Bp50)(CDw40)(CD40 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P25942]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40-M_domestica
Structure & Sequence [+]
Protein sequence [+]
CD40 | Monodelphis domestica | 13616 | length:241
PGTKLVTDCTEDSETQCMPCQEGEFQSSWNHDKYCHQHKYCDPNLHLQIQKEGSLEKDTI
CICTGGLHCSSPECESCSIHSPCQPGFGVYQTGTGTTDTICEPCKKGFYSNVSSAFEQCL
PWSSCEAPGLMKIQEGTDKTDVLCQLVYQNPVSPDRISLLVLIPITVGIVFAVITLFYWK
GWSKEPGRERKGHRTEPQEPPGKHPQENDEDPFPVQETLLRGQPVTQEDGKESRISEQEG
Q
CICTGGLHCSSPECESCSIHSPCQPGFGVYQTGTGTTDTICEPCKKGFYSNVSSAFEQCL
PWSSCEAPGLMKIQEGTDKTDVLCQLVYQNPVSPDRISLLVLIPITVGIVFAVITLFYWK
GWSKEPGRERKGHRTEPQEPPGKHPQENDEDPFPVQETLLRGQPVTQEDGKESRISEQEG
Q
Structure links:
- Smartdomain prediction information: SM00208
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | IEA |
GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IEA |
GO:0050776 | regulation of immune response | biological_proccess | IEA |
GO:0048304 | positive regulation of isotype switching to IgG isotypes | biological_proccess | IEA |
GO:0042113 | B cell activation | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0002768 | immune response-regulating cell surface receptor signaling pathway | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0019899 | enzyme binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0043231 | intracellular membrane-bounded organelle | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMODG00000013875
- Expression info from Arrayexpress [?] : ENSMODG00000013875
- Protein expression from Protein Atlas: [?] ENSMODG00000013875
Click on [?] for more information.