TNR6_MACMU (Macaca mulatta)
Description [+]
- Synonyms: TNR6_MACMU
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Cercopithecidae; Macaca mulatta
- Short gene description: Tumor necrosis factor receptor superfamily member 6 precursor (FASLG receptor) (Apoptosis-mediating surface antigen FAS) (Apo-1 antigen) (CD95 antigen). [Source:UniProtKB/Swiss-Prot;Acc:Q9BDP2]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNR6_MACMU-M_mulatta
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 85 | 127 |
PFAM A | TNFR_c6 | 129 | 165 |
PFAM A | Death | 229 | 312 |
Protein sequence [+]
TNR6_MACMU | Macaca mulatta | 9544 | length:333
MLGTWTLLPLVLTSVVRLLSKCVNAQVTDISSKGFELRKIVTTIETQNLEGLHHEGQFCR
NPCPPGERKARDCTVNEDEPDCVPCQEGKEYTDKGHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSAVCEHCDPCTKCKHGIIEECTLTSNTKCKEEDSRSDLLWLCLL
LLLLLIPPIVYVVIKKPCRKHRKENQGPHESTTLNPETAINLSDVDLSKYITTIAGAMTL
SQVKDFVRKNGVSEAKIDEIKNDNVQDTAEQKVQLLRNWYQLHGKKDACDTLIKGLKTAD
LCTLAEKIHAVILKDITSDTENSNFGNEVQNLV
NPCPPGERKARDCTVNEDEPDCVPCQEGKEYTDKGHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSAVCEHCDPCTKCKHGIIEECTLTSNTKCKEEDSRSDLLWLCLL
LLLLLIPPIVYVVIKKPCRKHRKENQGPHESTTLNPETAINLSDVDLSKYITTIAGAMTL
SQVKDFVRKNGVSEAKIDEIKNDNVQDTAEQKVQLLRNWYQLHGKKDACDTLIKGLKTAD
LCTLAEKIHAVILKDITSDTENSNFGNEVQNLV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002377 | immunoglobulin production | biological_proccess | IEA |
GO:0003014 | renal system process | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006924 | activation-induced cell death of T cells | biological_proccess | IEA |
GO:0006925 | inflammatory cell apoptosis | biological_proccess | IEA |
GO:0006927 | transformed cell apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0010467 | gene expression | biological_proccess | IEA |
GO:0019724 | B cell mediated immunity | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0045060 | negative thymic T cell selection | biological_proccess | IEA |
GO:0045619 | regulation of lymphocyte differentiation | biological_proccess | IEA |
GO:0045637 | regulation of myeloid cell differentiation | biological_proccess | IEA |
GO:0048536 | spleen development | biological_proccess | IEA |
GO:0050869 | negative regulation of B cell activation | biological_proccess | IEA |
GO:0051260 | protein homooligomerization | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0009986 | cell surface | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMMUG00000011186
- Expression info from Arrayexpress [?] : ENSMMUG00000011186
- Protein expression from Protein Atlas: [?] ENSMMUG00000011186
- entrezgene: 574332
- refseq_dna: NM_001032933
- refseq_peptide: NP_001028105
Click on [?] for more information.