NGFR (Mus musculus)
Description [+]
- Synonyms: NGFR
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: nerve growth factor receptor (TNFR superfamily, member 16) Gene [Source:MGI (curated);Acc:Ngfr-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NGFR-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 35 | 67 |
PFAM A | TNFR_c6 | 70 | 110 |
PFAM A | TNFR_c6 | 112 | 149 |
PFAM A | TNFR_c6 | 152 | 191 |
PFAM A | Death | 348 | 421 |
Protein sequence [+]
Ngfr | Mus musculus | 10090 | length:427
MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPC
GANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDE
ETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQL
RECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMG
SSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPE
GEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSE
STATSPV
GANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDE
ETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQL
RECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMG
SSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPE
GEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSE
STATSPV
Structure links:
- Smartdomain prediction information: SM00208
- Smartdomain prediction information: SM00005
- Prosite motif and domain information: PS00120
- Prosite motif and domain information: PS00652
- Prosite motif and domain information: PS01186
- Interpro domain information: Q9Z0W1
- PFAM domain and domain family information: Q9Z0W1
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006917 | induction of apoptosis | biological_proccess | IDA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007411 | axon guidance | biological_proccess | IMP |
GO:0007417 | central nervous system development | biological_proccess | IMP |
GO:0009611 | response to wounding | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IMP |
GO:0016048 | detection of temperature stimulus | biological_proccess | IMP |
GO:0021675 | nerve development | biological_proccess | IMP |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IMP |
GO:0040037 | negative regulation of fibroblast growth factor receptor signaling pathway | biological_proccess | IMP |
GO:0042488 | positive regulation of odontogenesis of dentine-containing tooth | biological_proccess | IMP |
GO:0043588 | skin development | biological_proccess | IMP |
GO:0048146 | positive regulation of fibroblast proliferation | biological_proccess | IMP |
GO:0048635 | negative regulation of muscle development | biological_proccess | IEA |
GO:0051799 | negative regulation of hair follicle development | biological_proccess | IMP |
GO:0007399 | nervous system development | biological_proccess | IEA |
GO:0030154 | cell differentiation | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0005030 | neurotrophin receptor activity | mollecular_function | IEA |
GO:0005035 | death receptor activity | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0048406 | nerve growth factor binding | mollecular_function | IDA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:97323
- Ensembl genome browser [?] : ENSMUSG00000000120
- Expression info from Arrayexpress [?] : ENSMUSG00000000120
- Protein expression from Protein Atlas: [?] ENSMUSG00000000120
- Community gene edition from Wikigenes: [?] 18053
Click on [?] for more information.