CD40 (Mus musculus)
Description [+]
- Synonyms: CD40
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: CD40 antigen Gene [Source:MGI (curated);Acc:Cd40-005]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 26 | 59 |
Protein sequence [+]
Cd40 | Mus musculus | 10090 | length:289
MVSLPRLCALWGCLLTAVHLGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCH
PCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACA
QHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTS
QTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEM
EDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV
PCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACA
QHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTS
QTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEM
EDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002768 | immune response-regulating cell surface receptor signaling pathway | biological_proccess | IDA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | IGI |
GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IDA |
GO:0042113 | B cell activation | biological_proccess | IDA |
GO:0048304 | positive regulation of isotype switching to IgG isotypes | biological_proccess | IDA |
GO:0050776 | regulation of immune response | biological_proccess | IDA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IDA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0019899 | enzyme binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IDA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0043231 | intracellular membrane-bounded organelle | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:88336
- Ensembl genome browser [?] : ENSMUSG00000017652
- Expression info from Arrayexpress [?] : ENSMUSG00000017652
- Protein expression from Protein Atlas: [?] ENSMUSG00000017652
- Community gene edition from Wikigenes: [?] 21939
Click on [?] for more information.