TNFRSF4 (Mus musculus)
Description [+]
- Synonyms: TNFRSF4
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: tumor necrosis factor receptor superfamily, member 4 Gene [Source:MGI (curated);Acc:Tnfrsf4-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF4-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 27 | 60 |
PFAM A | TNFR_c6 | 63 | 103 |
Protein sequence [+]
Tnfrsf4 | Mus musculus | 10090 | length:272
MYVWVQQPTALLLLGLTLGVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLC
HPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLG
VDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRP
TFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLGLLAPLTVLLALYLLRKAW
RLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI
HPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLG
VDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRP
TFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLGLLAPLTVLLALYLLRKAW
RLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006954 | inflammatory response | biological_proccess | IPI |
GO:0006968 | cellular defense response | biological_proccess | IMP |
GO:0042981 | regulation of apoptosis | biological_proccess | IMP |
GO:0045859 | regulation of protein kinase activity | biological_proccess | IMP |
GO:0050710 | negative regulation of cytokine secretion | biological_proccess | IPI |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | IMP |
GO:0032582 | negative regulation of gene-specific transcription | biological_proccess | IDA |
GO:0043433 | negative regulation of transcription factor activity | biological_proccess | IDA |
GO:0051024 | positive regulation of immunoglobulin secretion | biological_proccess | IDA |
GO:0042098 | T cell proliferation | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | IPI |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005886 | plasma membrane | cell_component | IDA |
GO:0009897 | external side of plasma membrane | cell_component | IDA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:104512
- Ensembl genome browser [?] : ENSMUSG00000029075
- Expression info from Arrayexpress [?] : ENSMUSG00000029075
- Protein expression from Protein Atlas: [?] ENSMUSG00000029075
- Community gene edition from Wikigenes: [?] 22163
Click on [?] for more information.