TNFRSF14 (Mus musculus)
Description [+]
- Synonyms: TNFRSF14
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) Gene [Source:MGI (curated);Acc:Tnfrsf14-005]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF14-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 78 | 119 |
Protein sequence [+]
Tnfrsf14 | Mus musculus | 10090 | length:275
MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQEEFLVGDECCPMCNPG
YHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCR
CIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECL
PWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVGAGIAGFLICTRRHLHTSS
VAKELEPFQEQQENTIRFPVTEVGFAETEEETASN
YHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCR
CIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECL
PWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVGAGIAGFLICTRRHLHTSS
VAKELEPFQEQQENTIRFPVTEVGFAETEEETASN
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0046642 | negative regulation of alpha-beta T cell proliferation | biological_proccess | IDA |
GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | biological_proccess | IDA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:2675303
- Ensembl genome browser [?] : ENSMUSG00000042333
- Expression info from Arrayexpress [?] : ENSMUSG00000042333
- Protein expression from Protein Atlas: [?] ENSMUSG00000042333
- Community gene edition from Wikigenes: [?] 230979
Click on [?] for more information.