CALR (Pongo pygmaeus)
Description [+]
- Synonyms: CALR
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pongo pygmaeus
- Short gene description: Calreticulin Precursor (CRP55)(Calregulin)(HACBP)(ERp60)(grp60) [Source:UniProtKB/Swiss-Prot;Acc:P27797]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CALR-P_pygmaeus
Structure & Sequence [+]
Protein sequence [+]
CALR | Pongo pygmaeus | 9600 | length:417
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006457 | protein folding | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0007050 | cell cycle arrest | biological_proccess | IEA |
GO:0006611 | protein export from nucleus | biological_proccess | IEA |
GO:0045740 | positive regulation of DNA replication | biological_proccess | IEA |
GO:0033144 | negative regulation of steroid hormone receptor signaling pathway | biological_proccess | IEA |
GO:0045665 | negative regulation of neuron differentiation | biological_proccess | IEA |
GO:0048387 | negative regulation of retinoic acid receptor signaling pathway | biological_proccess | IEA |
GO:0010149 | senescence | biological_proccess | IEA |
GO:0045787 | positive regulation of cell cycle | biological_proccess | IEA |
GO:0030866 | cortical actin cytoskeleton organization | biological_proccess | IEA |
GO:0050766 | positive regulation of phagocytosis | biological_proccess | IEA |
GO:0040020 | regulation of meiosis | biological_proccess | IEA |
GO:0002502 | peptide antigen assembly with MHC class I protein complex | biological_proccess | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0051082 | unfolded protein binding | mollecular_function | IEA |
GO:0016564 | transcription repressor activity | mollecular_function | IEA |
GO:0005178 | integrin binding | mollecular_function | IEA |
GO:0050681 | androgen receptor binding | mollecular_function | IEA |
GO:0003729 | mRNA binding | mollecular_function | IEA |
GO:0008937 | ferredoxin reductase activity | mollecular_function | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005788 | endoplasmic reticulum lumen | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005792 | microsome | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0005844 | polysome | cell_component | IEA |
GO:0042824 | MHC class I peptide loading complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPPYG00000009616
- Expression info from Arrayexpress [?] : ENSPPYG00000009616
- Protein expression from Protein Atlas: [?] ENSPPYG00000009616
Click on [?] for more information.