A0EJI1_PONPY (Pongo pygmaeus)
Description [+]
- Synonyms: A0EJI1_PONPY
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pongo pygmaeus
- Short gene description: BAX (Fragment). [Source:UniProtKB/TrEMBL;Acc:A0EJI1]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: A0EJI1_PONPY-P_pygmaeus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2 | 63 | 133 |
Protein sequence [+]
A0EJI1_PONPY | Pongo pygmaeus | 9600 | length:167
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALWTLDFLR
ERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALWTLDFLR
ERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007281 | germ cell development | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0007283 | spermatogenesis | biological_proccess | IEA |
GO:0006808 | regulation of nitrogen utilization | biological_proccess | IEA |
GO:0009791 | post-embryonic development | biological_proccess | IEA |
GO:0048873 | homeostasis of number of cells within a tissue | biological_proccess | IEA |
GO:0001541 | ovarian follicle development | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0010212 | response to ionizing radiation | biological_proccess | IEA |
GO:0007399 | nervous system development | biological_proccess | IEA |
GO:0007548 | sex differentiation | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0048147 | negative regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0001822 | kidney development | biological_proccess | IEA |
GO:0001764 | neuron migration | biological_proccess | IEA |
GO:0009566 | fertilization | biological_proccess | IEA |
GO:0048872 | homeostasis of number of cells | biological_proccess | IEA |
GO:0042475 | odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0051402 | neuron apoptosis | biological_proccess | IEA |
GO:0051260 | protein homooligomerization | biological_proccess | IEA |
GO:0031558 | induction of apoptosis in response to chemical stimulus | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0019987 | negative regulation of anti-apoptosis | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0001101 | response to acid | biological_proccess | IEA |
GO:0001974 | blood vessel remodeling | biological_proccess | IEA |
GO:0002262 | myeloid cell homeostasis | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0008629 | induction of apoptosis by intracellular signals | biological_proccess | IEA |
GO:0021987 | cerebral cortex development | biological_proccess | IEA |
GO:0051281 | positive regulation of release of sequestered calcium ion into cytosol | biological_proccess | IEA |
GO:0008637 | apoptotic mitochondrial changes | biological_proccess | IEA |
GO:0060041 | retina development in camera-type eye | biological_proccess | IEA |
GO:0001783 | B cell apoptosis | biological_proccess | IEA |
GO:0001844 | protein insertion into mitochondrial membrane during induction of apoptosis | biological_proccess | IEA |
GO:0009611 | response to wounding | biological_proccess | IEA |
GO:0006687 | glycosphingolipid metabolic process | biological_proccess | IEA |
GO:0035234 | germ cell programmed cell death | biological_proccess | IEA |
GO:0048678 | response to axon injury | biological_proccess | IEA |
GO:0008053 | mitochondrial fusion | biological_proccess | IEA |
GO:0043281 | regulation of caspase activity | biological_proccess | IEA |
GO:0035108 | limb morphogenesis | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0048087 | positive regulation of pigmentation during development | biological_proccess | IEA |
GO:0045136 | development of secondary sexual characteristics | biological_proccess | IEA |
GO:0060058 | positive regulation of apoptosis involved in mammary gland involution | biological_proccess | IEA |
GO:0002904 | positive regulation of B cell apoptosis | biological_proccess | IEA |
GO:0048597 | post-embryonic camera-type eye morphogenesis | biological_proccess | IEA |
GO:0002358 | B cell homeostatic proliferation | biological_proccess | IEA |
GO:0009651 | response to salt stress | biological_proccess | IEA |
GO:0001776 | leukocyte homeostasis | biological_proccess | IEA |
GO:0060011 | Sertoli cell proliferation | biological_proccess | IEA |
GO:0021854 | hypothalamus development | biological_proccess | IEA |
GO:0033137 | negative regulation of peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0046666 | retinal cell programmed cell death | biological_proccess | IEA |
GO:0034644 | cellular response to UV | biological_proccess | IEA |
GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IEA |
GO:0002352 | B cell negative selection | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IEA |
GO:0010524 | positive regulation of calcium ion transport into cytosol | biological_proccess | IEA |
GO:0032471 | reduction of endoplasmic reticulum calcium ion concentration | biological_proccess | IEA |
GO:0060068 | vagina development | biological_proccess | IEA |
GO:0048515 | spermatid differentiation | biological_proccess | IEA |
GO:0001777 | T cell homeostatic proliferation | biological_proccess | IEA |
GO:0030264 | nuclear fragmentation during apoptosis | biological_proccess | IEA |
GO:0033599 | regulation of mammary gland epithelial cell proliferation | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0051434 | BH3 domain binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005741 | mitochondrial outer membrane | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
GO:0044445 | cytosolic part | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPPYG00000010222
- Expression info from Arrayexpress [?] : ENSPPYG00000010222
- Protein expression from Protein Atlas: [?] ENSPPYG00000010222
Click on [?] for more information.