RIPK2 (Pan troglodytes)
Description [+]
- Synonyms: RIPK2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Receptor-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1)(RIP-like-interacting CLARP kinase)(Receptor-interacting protein 2)(RIP-2)(CARD-containing interleukin-1 beta-converting enzyme-associated kinase)(CARD-containing IL-1 beta ICE-kinase) [Source:UniProtKB/Swiss-Prot;Acc:O43353]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: RIPK2-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 18 | 290 |
PFAM A | Pkinase_Tyr | 18 | 290 |
PFAM A | CARD | 436 | 523 |
Protein sequence [+]
RIPK2 | Pan troglodytes | 9598 | length:539
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAQDNDFSSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINP
LSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKP
TRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSSSLHLLQNKSM
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAQDNDFSSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINP
LSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKP
TRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSSSLHLLQNKSM
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0034134 | toll-like receptor 2 signaling pathway | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0032729 | positive regulation of interferon-gamma production | biological_proccess | IEA |
GO:0032743 | positive regulation of interleukin-2 production | biological_proccess | IEA |
GO:0032760 | positive regulation of tumor necrosis factor production | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0032755 | positive regulation of interleukin-6 production | biological_proccess | IEA |
GO:0032874 | positive regulation of stress-activated MAPK cascade | biological_proccess | IEA |
GO:0043330 | response to exogenous dsRNA | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0050830 | defense response to Gram-positive bacterium | biological_proccess | IEA |
GO:0070374 | positive regulation of ERK1 and ERK2 cascade | biological_proccess | IEA |
GO:0032494 | response to peptidoglycan | biological_proccess | IEA |
GO:0050852 | T cell receptor signaling pathway | biological_proccess | IEA |
GO:0046641 | positive regulation of alpha-beta T cell proliferation | biological_proccess | IEA |
GO:0042098 | T cell proliferation | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0034142 | toll-like receptor 4 signaling pathway | biological_proccess | IEA |
GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway | biological_proccess | IEA |
GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway | biological_proccess | IEA |
GO:0032722 | positive regulation of chemokine production | biological_proccess | IEA |
GO:0070555 | biological_proccess | IEA | |
GO:0070391 | response to lipoteichoic acid | biological_proccess | IEA |
GO:0033091 | positive regulation of immature T cell proliferation | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0050700 | CARD domain binding | mollecular_function | IEA |
GO:0030274 | LIM domain binding | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000020405
- Expression info from Arrayexpress [?] : ENSPTRG00000020405
- Protein expression from Protein Atlas: [?] ENSPTRG00000020405
- entrezgene: 464277
Click on [?] for more information.