CASP1 (Rattus norvegicus)
Description [+]
- Synonyms: CASP1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Caspase-1 precursor (EC 3.4.22.36) (CASP-1) (Interleukin-1 beta convertase) (IL-1BC) (IL-1 beta-converting enzyme) (ICE) (Interleukin- 1 beta-converting enzyme) (p45) [Contains: Caspase-1 subunit p20; Caspase-1 subunit p10]. [Source:UniProtKB/Swiss-Prot;Acc:P43527]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CASP1-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | CARD | 3 | 90 |
| PFAM A | Peptidase_C14 | 162 | 398 |
Protein sequence [+]
Casp1 | Rattus norvegicus | 10116 | length:402
MADKILRAKRKQFINSVSVGTINGLLDELLEKRVLNQEEMDTIKLANITVMEKARDLCDH
VTKKGPRASQMFITYICNEDCYLAEILELQSGPSAETVFVTEDSKGGHPFSSETKEKLNK
EGGAFPGPSGSLKFCPLEIAQKLWKENHSEIYPIMKTPTRTRLALIICNTDFQHLSRRVG
ADVDLREMKLLLQDLGYTVKVKENLTALEMTKELKEFAACPEHKTSDSTFLVFMSHGLQE
GICGITYSNEVADILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVGN
SEEGFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVQGSLFIESLIKHMKEYAW
SCDLEDIFRKVRFSFEQPDSRLQMPTTERVTLTKRFYLFPGH
VTKKGPRASQMFITYICNEDCYLAEILELQSGPSAETVFVTEDSKGGHPFSSETKEKLNK
EGGAFPGPSGSLKFCPLEIAQKLWKENHSEIYPIMKTPTRTRLALIICNTDFQHLSRRVG
ADVDLREMKLLLQDLGYTVKVKENLTALEMTKELKEFAACPEHKTSDSTFLVFMSHGLQE
GICGITYSNEVADILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVGN
SEEGFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVQGSLFIESLIKHMKEYAW
SCDLEDIFRKVRFSFEQPDSRLQMPTTERVTLTKRFYLFPGH
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0001666 | response to hypoxia | biological_proccess | IEA |
| GO:0006508 | proteolysis | biological_proccess | IEA |
| GO:0006917 | induction of apoptosis | biological_proccess | IEA |
| GO:0008219 | cell death | biological_proccess | IEA |
| GO:0016485 | protein processing | biological_proccess | IEA |
| GO:0033198 | response to ATP | biological_proccess | IEA |
| GO:0042221 | response to chemical stimulus | biological_proccess | IEA |
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IEA |
| GO:0050717 | positive regulation of interleukin-1 alpha secretion | biological_proccess | IEA |
| GO:0050718 | positive regulation of interleukin-1 beta secretion | biological_proccess | IEA |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
| GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0008233 | peptidase activity | mollecular_function | IEA |
| GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
| GO:0005576 | extracellular region | cell_component | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
| GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000007372
- Expression info from Arrayexpress [?] : ENSRNOG00000007372
- Protein expression from Protein Atlas: [?] ENSRNOG00000007372
Click on [?] for more information.
