TNFRSF11B (Rattus norvegicus)
Description [+]
- Synonyms: TNFRSF11B
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tumor necrosis factor receptor superfamily member 11B precursor (Osteoprotegerin). [Source:UniProtKB/Swiss-Prot;Acc:O08727]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF11B-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 65 | 105 |
PFAM A | Death | 279 | 365 |
Protein sequence [+]
Tnfrsf11b | Rattus norvegicus | 10116 | length:401
MNKWLCCALLVFLDIIEWTTQETFPPKYLHYDPETGRQLLCDKCAPGTYLKQHCTVRRKT
LCVPCPDYSYTDSWHTSDECVYCSPVCKELQTVKQECNRTHNRVCECEEGRYLELEFCLK
HRSCPPGLGVLQAGTPERNTVCKRCPDGFFSGETSSKAPCRKHTNCSSLGLLLIQKGNAT
HDNVCSGNREATQNCGIDVTLCEEAFFRFAVPTKIIPNWLSVLVDSLPGTKVNAESVERI
KRRHSSQEQTFQLLKLWKHQNRDQEMVKKIIQDIDLCESSVQRHIGHANLTTEQLRILME
SLPGKKISPDEIERTRKTCKPSEQLLKLLSLWRIKNGDQDTLKGLMYALKHLKAYHFPKT
VTHSLRKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
LCVPCPDYSYTDSWHTSDECVYCSPVCKELQTVKQECNRTHNRVCECEEGRYLELEFCLK
HRSCPPGLGVLQAGTPERNTVCKRCPDGFFSGETSSKAPCRKHTNCSSLGLLLIQKGNAT
HDNVCSGNREATQNCGIDVTLCEEAFFRFAVPTKIIPNWLSVLVDSLPGTKVNAESVERI
KRRHSSQEQTFQLLKLWKHQNRDQEMVKKIIQDIDLCESSVQRHIGHANLTTEQLRILME
SLPGKKISPDEIERTRKTCKPSEQLLKLLSLWRIKNGDQDTLKGLMYALKHLKAYHFPKT
VTHSLRKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007584 | response to nutrient | biological_proccess | IEP |
GO:0030198 | extracellular matrix organization | biological_proccess | IEA |
GO:0032026 | response to magnesium ion | biological_proccess | IEP |
GO:0042489 | negative regulation of odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEP |
GO:0043627 | response to estrogen stimulus | biological_proccess | IEP |
GO:0045671 | negative regulation of osteoclast differentiation | biological_proccess | TAS |
GO:0045779 | negative regulation of bone resorption | biological_proccess | IDA |
GO:0046685 | response to arsenic | biological_proccess | IEP |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005578 | proteinaceous extracellular matrix | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000008336
- Expression info from Arrayexpress [?] : ENSRNOG00000008336
- Protein expression from Protein Atlas: [?] ENSRNOG00000008336
Click on [?] for more information.