CYCS (Rattus norvegicus)
Description [+]
- Synonyms: CYCS
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Cytochrome c, somatic. [Source:UniProtKB/Swiss-Prot;Acc:P62898]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CYCS-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Cytochrom_C | 4 | 103 |
Protein sequence [+]
Cycs | Rattus norvegicus | 10116 | length:105
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006123 | mitochondrial electron transport, cytochrome c to oxygen | biological_proccess | IDA |
GO:0006810 | transport | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IDA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | TAS |
GO:0022900 | electron transport chain | biological_proccess | IEA |
GO:0009055 | electron carrier activity | mollecular_function | IEA |
GO:0020037 | heme binding | mollecular_function | IEA |
GO:0008289 | lipid binding | mollecular_function | TAS |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005506 | iron ion binding | mollecular_function | IEA |
GO:0005625 | soluble fraction | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005746 | mitochondrial respiratory chain | cell_component | IC |
GO:0005759 | mitochondrial matrix | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000010452
- Expression info from Arrayexpress [?] : ENSRNOG00000010452
- Protein expression from Protein Atlas: [?] ENSRNOG00000010452
Click on [?] for more information.