CASP3 (Rattus norvegicus)
Description [+]
- Synonyms: CASP3
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Caspase-3 precursor (EC 3.4.22.56) (CASP-3) (Apopain) (Cysteine protease CPP32) (Yama protein) (CPP-32) (SREBP cleavage activity 1) (SCA-1) (LICE) (IRP) [Contains: Caspase-3 subunit p17; Caspase-3 subunit p12]. [Source:UniProtKB/Swiss-Prot;Acc:P55213]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CASP3-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Peptidase_C14 | 45 | 275 |
Protein sequence [+]
Casp3 | Rattus norvegicus | 10116 | length:277
MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTG
MSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILS
HGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDD
DMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH
MSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILS
HGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDD
DMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0001666 | response to hypoxia | biological_proccess | IEP |
| GO:0006508 | proteolysis | biological_proccess | IEA |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0006917 | induction of apoptosis | biological_proccess | TAS |
| GO:0007242 | intracellular signaling cascade | biological_proccess | IMP |
| GO:0007611 | learning or memory | biological_proccess | IMP |
| GO:0010038 | response to metal ion | biological_proccess | IEP |
| GO:0010165 | response to X-ray | biological_proccess | IEP |
| GO:0014070 | response to organic cyclic substance | biological_proccess | IEP |
| GO:0021766 | hippocampus development | biological_proccess | IEP |
| GO:0030182 | neuron differentiation | biological_proccess | IEP |
| GO:0032496 | response to lipopolysaccharide | biological_proccess | IEP |
| GO:0042060 | wound healing | biological_proccess | IEP |
| GO:0042493 | response to drug | biological_proccess | IEP |
| GO:0042542 | response to hydrogen peroxide | biological_proccess | IDA |
| GO:0043200 | response to amino acid stimulus | biological_proccess | IEP |
| GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IMP |
| GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEP |
| GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
| GO:0008233 | peptidase activity | mollecular_function | IEA |
| GO:0016005 | phospholipase A2 activator activity | mollecular_function | IMP |
| GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
| GO:0005625 | soluble fraction | cell_component | IDA |
| GO:0005737 | cytoplasm | cell_component | IEA |
| GO:0005829 | cytosol | cell_component | IMP |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000010475
- Expression info from Arrayexpress [?] : ENSRNOG00000010475
- Protein expression from Protein Atlas: [?] ENSRNOG00000010475
Click on [?] for more information.
