LOC684140 (Rattus norvegicus)
Description [+]
- Synonyms: LOC684140
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Bcl2-like 1 isoform 3 [Source:RefSeq_peptide;Acc:NP_001028843]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LOC684140-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 1 | 27 |
Protein sequence [+]
LOC684140 | Rattus norvegicus | 10116 | length:170
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLA
DSPEVNGATGHSSSLEAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
DSPEVNGATGHSSSLEAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001541 | ovarian follicle development | biological_proccess | IMP |
GO:0001666 | response to hypoxia | biological_proccess | IEP |
GO:0006916 | anti-apoptosis | biological_proccess | IDA |
GO:0006979 | response to oxidative stress | biological_proccess | IEP |
GO:0010035 | response to inorganic substance | biological_proccess | IEP |
GO:0010243 | response to organic nitrogen | biological_proccess | IEP |
GO:0010288 | response to lead ion | biological_proccess | IEP |
GO:0014070 | response to organic cyclic substance | biological_proccess | IEP |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IEP |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043434 | response to peptide hormone stimulus | biological_proccess | IEP |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0043027 | caspase inhibitor activity | mollecular_function | IDA |
GO:0000299 | integral to membrane of membrane fraction | cell_component | TAS |
GO:0005740 | mitochondrial envelope | cell_component | IDA |
GO:0005741 | mitochondrial outer membrane | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000018503
- Expression info from Arrayexpress [?] : ENSRNOG00000018503
- Protein expression from Protein Atlas: [?] ENSRNOG00000018503
- entrezgene: 293190
- entrezgene: 24888
- entrezgene: 684140
- refseq_dna: NM_001033671
- refseq_peptide: NP_001028843
Click on [?] for more information.