TNFRSF4 (Rattus norvegicus)
Description [+]
- Synonyms: TNFRSF4
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tumor necrosis factor receptor superfamily member 4 precursor (OX40L receptor) (OX40 antigen) (MRC OX40). [Source:UniProtKB/Swiss-Prot;Acc:P15725]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF4-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 26 | 59 |
PFAM A | TNFR_c6 | 62 | 102 |
Protein sequence [+]
Tnfrsf4 | Rattus norvegicus | 10116 | length:271
MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCH
PCEPGFYNEAVNYDTCKQCTQCNHRDGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGV
DCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTT
FRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWR
SPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI
PCEPGFYNEAVNYDTCKQCTQCNHRDGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGV
DCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTT
FRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWR
SPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006968 | cellular defense response | biological_proccess | IEA |
GO:0042098 | T cell proliferation | biological_proccess | IMP |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0045859 | regulation of protein kinase activity | biological_proccess | IEA |
GO:0050710 | negative regulation of cytokine secretion | biological_proccess | IEA |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | IEA |
GO:0051024 | positive regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0043433 | negative regulation of transcription factor activity | biological_proccess | IEA |
GO:0032582 | negative regulation of gene-specific transcription | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000020106
- Expression info from Arrayexpress [?] : ENSRNOG00000020106
- Protein expression from Protein Atlas: [?] ENSRNOG00000020106
Click on [?] for more information.