BAD_V2 (Rattus norvegicus)
Description [+]
- Synonyms: BAD_V2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Bcl2 antagonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl- xL/Bcl-2-associated death promoter). [Source:UniProtKB/Swiss-Prot;Acc:O35147]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BAD_V2-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2_BAD | 43 | 205 |
Protein sequence [+]
Bad_v2 | Rattus norvegicus | 10116 | length:205
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTT
DRGLGPSLTEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGGAGTMETRSRHSSYPAGTEE
DEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQ
SASWTRIIQSWWDRNLGKGGSTPSQ
DRGLGPSLTEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGGAGTMETRSRHSSYPAGTEE
DEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQ
SASWTRIIQSWWDRNLGKGGSTPSQ
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0042593 | glucose homeostasis | biological_proccess | IEA |
GO:0019221 | cytokine-mediated signaling pathway | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0045582 | positive regulation of T cell differentiation | biological_proccess | IEA |
GO:0045579 | positive regulation of B cell differentiation | biological_proccess | IEA |
GO:0043281 | regulation of caspase activity | biological_proccess | IEA |
GO:0006007 | glucose catabolic process | biological_proccess | IEA |
GO:0001666 | response to hypoxia | biological_proccess | IEP |
GO:0006917 | induction of apoptosis | biological_proccess | IMP |
GO:0009725 | response to hormone stimulus | biological_proccess | IEP |
GO:0009749 | response to glucose stimulus | biological_proccess | IEP |
GO:0014070 | response to organic cyclic substance | biological_proccess | IEP |
GO:0032355 | response to estradiol stimulus | biological_proccess | IEP |
GO:0032570 | response to progesterone stimulus | biological_proccess | IEP |
GO:0033574 | response to testosterone stimulus | biological_proccess | IEP |
GO:0034201 | response to oleate | biological_proccess | IEP |
GO:0042493 | response to drug | biological_proccess | IEP |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IEP |
GO:0043200 | response to amino acid stimulus | biological_proccess | IEP |
GO:0045471 | response to ethanol | biological_proccess | IEP |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEP |
GO:0051592 | response to calcium ion | biological_proccess | IEP |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0030346 | protein phosphatase 2B binding | mollecular_function | IPI |
GO:0043422 | protein kinase B binding | mollecular_function | IPI |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005741 | mitochondrial outer membrane | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000021147
- Expression info from Arrayexpress [?] : ENSRNOG00000021147
- Protein expression from Protein Atlas: [?] ENSRNOG00000021147
Click on [?] for more information.