TNFRSF1A (Rattus norvegicus)
Description [+]
- Synonyms: TNFRSF1A
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tumor necrosis factor receptor superfamily member 1A precursor (p60) (TNF-R1) (TNF-RI) (TNFR-I) (p55). [Source:UniProtKB/Swiss-Prot;Acc:P22934]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF1A-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 46 | 83 |
PFAM A | TNFR_c6 | 86 | 127 |
PFAM A | TNFR_c6 | 129 | 168 |
PFAM A | Death | 366 | 450 |
Protein sequence [+]
Tnfrsf1a | Rattus norvegicus | 10116 | length:465
HSLTSVPPSPAVVSLVLLALLMGIHPSGVTGLVPSLGDREKRDNLCPQGKYAHPKNNSIC
CTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCK
ADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNE
CTPCSHCKKNQECMKLCLPPVANVTNPQDSGTAVLLPLVIFLGLCLLFFICISLLCRYPQ
WRPRVYSIICRDSAPVKEVEGEGIVTKPLTPASIPAFSPNPGFNPTLGFSTTPRFSPPVS
STPISPVFGPSNWHNFVPPVREVVPTQGADPLLYGSLNPVPIPAPVRKWEDVVAAQPQRL
DTADPAMLYAVVDGVPPTRWKEFMRLLGLSEHEIERLELQNGRCLREAHYSMLEAWRRRT
PRHEATLDVVGRVLCDMNLRGCLENIRETLESPAGSVPSAPRQLR
CTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCK
ADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNE
CTPCSHCKKNQECMKLCLPPVANVTNPQDSGTAVLLPLVIFLGLCLLFFICISLLCRYPQ
WRPRVYSIICRDSAPVKEVEGEGIVTKPLTPASIPAFSPNPGFNPTLGFSTTPRFSPPVS
STPISPVFGPSNWHNFVPPVREVVPTQGADPLLYGSLNPVPIPAPVRKWEDVVAAQPQRL
DTADPAMLYAVVDGVPPTRWKEFMRLLGLSEHEIERLELQNGRCLREAHYSMLEAWRRRT
PRHEATLDVVGRVLCDMNLRGCLENIRETLESPAGSVPSAPRQLR
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006693 | prostaglandin metabolic process | biological_proccess | ISS |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0019221 | cytokine-mediated signaling pathway | biological_proccess | ISS |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEP |
GO:0045471 | response to ethanol | biological_proccess | IEP |
GO:0045766 | positive regulation of angiogenesis | biological_proccess | IMP |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | ISS |
GO:0050729 | positive regulation of inflammatory response | biological_proccess | ISS |
GO:0051291 | protein heterooligomerization | biological_proccess | IPI |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006952 | defense response | biological_proccess | IEA |
GO:0019221 | cytokine-mediated signaling pathway | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0050729 | positive regulation of inflammatory response | biological_proccess | IEA |
GO:0009816 | defense response to bacterium, incompatible interaction | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | ISS |
GO:0032403 | protein complex binding | mollecular_function | IPI |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0043234 | protein complex | cell_component | IDA |
GO:0045121 | membrane raft | cell_component | IDA |
GO:0045121 | membrane raft | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000031312
- Expression info from Arrayexpress [?] : ENSRNOG00000031312
- Protein expression from Protein Atlas: [?] ENSRNOG00000031312
Click on [?] for more information.