AVEN (Homo sapiens)
Description [+]
- Synonyms: AVEN, PDCD12
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Cell death regulator Aven [Source:UniProtKB/Swiss-Prot;Acc:Q9NQS1]
- Family: other
- Process: apoptosis,
- Pathways: intrinsic pathway,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Aven
- WIKI: AVEN-H_sapiens
References [+]
- Aven, a novel inhibitor of caspase activation, binds Bcl-xL and Apaf-1.
- Chau BN, Cheng EH, Kerr DA, Hardwick JM
- Bcl-x(L), an antiapoptotic Bcl-2 family member, is postulated to function at multiple stages in the cell death pathway. The possibility that Bcl-x(L) inhibits cell death at a late (postmitochondrial) step in the death pathway is supported by this report of a novel apoptosis inhibitor, Aven, which binds to both Bcl-x(L) and the caspase regulator, Apaf-1. Identified in a yeast two-hybrid screen, Aven is broadly expressed and is conserved in other mammalian species. Only those mutants of Bcl-x(L)that retain their antiapoptotic activity are capable of binding Aven. Aven interferes with the ability of Apaf-1 to self-associate, suggesting that Aven impairs Apaf-1-mediated activation of caspases. Consistent with this idea, Aven inhibited the proteolytic activation of caspases in a cell-free extract and suppressed apoptosis induced by Apaf-1 plus caspase-9. Thus, Aven represents a new class of cell death regulator. Mol Cell. 2000 Jul;6(1):31-40.
Structure & Sequence [+]
Protein sequence [+]
AVEN | Homo sapiens | 9606 | length:362
MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFR
GARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDR
YQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDS
ELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGP
IFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGD
NILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSM
IS
GARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDR
YQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDS
ELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGP
IFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGD
NILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSM
IS
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| NP_001005791.1 | orthology | Chicken |
| AVEN | orthology | Chimpanzee |
| AVEN | orthology | Cow |
| AVEN | orthology | Dog |
| AVEN | orthology | Fugu |
| AVEN | orthology | Gasterosteus |
| AVEN | orthology | Gorilla |
| AVEN | orthology | Lyzard |
| AVEN | orthology | Macaca |
| AVEN | orthology | Monodelphis |
| Aven | orthology | Mouse |
| AVEN | orthology | Orangutan |
| AVEN | orthology | Ornithorhynchus |
| AVEN | orthology | Rabbit |
| NP_001101227.1 | orthology | Rat |
| AVEN | orthology | Tetraodon |
| AVEN | orthology | Xenopus |
| AVEN | orthology | Zebra finch |
| zgc:136239 | orthology | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0006916 | anti-apoptosis | biological_proccess | IDA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0016020 | membrane | cell_component | IEA |
| GO:0005624 | membrane fraction | cell_component | IDA |
| GO:0005622 | intracellular | cell_component | IDA |
Check GO Evidence Codes here
Curated Isoforms [+]
| Transcript | Translation |
|---|---|
| OTTHUMT00000251523 * | OTTHUMP00000159733 * |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :13509
- Gene related info from GeneCards [?] : AVEN
- Ensembl genome browser [?] : ENSG00000169857
- Expression info from Arrayexpress [?] : ENSG00000169857
- Protein expression from Protein Atlas: [?] ENSG00000169857
- Community gene edition from Wikigenes: [?] 57099
- OMIM gene information: 605265
- OMIM disease information:
Click on [?] for more information.
